TAB1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TAB1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAB1.
  
  

  Source: E. coli

  Amino Acid Sequence: EQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TAB1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38819.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TAB1 Recombinant Protein Antigen

• MAP3K7IP1
• MAP3K7IP13'-Tab1
• MGC57664
• mitogen-activated protein kinase kinase kinase 7 interacting protein 1
• Mitogen-activated protein kinase kinase kinase 7-interacting protein 1
• TAB1
• TAK1-binding protein 1
• TGF-beta activated kinase 1/MAP3K7 binding protein 1
• TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
• TGF-beta-activated kinase 1-binding protein 1
• transforming growth factor beta-activated kinase-binding protein 1

Background

TAB1, TAK1 binding protein, enhances activity of the plasminogen activator inhibitor 1 gene promoter, which is regulated by TGF-beta, and increases the kinase activity of TAK1. TAB1 may function as an activator of the TAK1 MAPKKK in TGF-beta signal transduction (1). Findings suggest that alternative activation pathways contribute to the biological responses of p38alpha to various stimuli. Interaction of p38alpha with TAB1 leads to autophosphorylation and activation of p38alpha (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TAB1