T cell receptor delta locus Antibody (2H6)

Images

 
Western Blot: T cell receptor delta locus Antibody (2H6) [H00006964-M01] - TRD@ monoclonal antibody (M01), clone 2H6 Analysis of TRD@ expression in Hela S3 NE.
Sandwich ELISA: T cell receptor delta locus Antibody (2H6) [H00006964-M01] - Detection limit for recombinant GST tagged TRD@ is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

T cell receptor delta locus Antibody (2H6) Summary

Immunogen
TRD@ (CAA29800, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR
Specificity
TRD@ - T cell receptor delta locus
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00006964-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for T cell receptor delta locus Antibody (2H6)

  • C)
  • D
  • FLJ52034
  • FLJ52576
  • FLJ53668
  • FLJ54555
  • FLJ55265
  • FLJ56790
  • J
  • T cell receptor delta locus
  • T-cell antigen receptor, delta polypeptide
  • T-cell receptor, delta (V
  • TCRD
  • TCRDV1
  • TRD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-74080
Species: Hu
Applications: WB
H00006976-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-45883
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-74190
Species: Mu
Applications: WB, ChIP
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow

Publications for T cell receptor delta locus Antibody (H00006964-M01)(1)

Reviews for T cell receptor delta locus Antibody (H00006964-M01) (0)

There are no reviews for T cell receptor delta locus Antibody (H00006964-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for T cell receptor delta locus Antibody (H00006964-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional T cell receptor delta locus Products

Bioinformatics Tool for T cell receptor delta locus Antibody (H00006964-M01)

Discover related pathways, diseases and genes to T cell receptor delta locus Antibody (H00006964-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for T cell receptor delta locus Antibody (H00006964-M01)

Discover more about diseases related to T cell receptor delta locus Antibody (H00006964-M01).
 

Pathways for T cell receptor delta locus Antibody (H00006964-M01)

View related products by pathway.

Blogs on T cell receptor delta locus

There are no specific blogs for T cell receptor delta locus, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our T cell receptor delta locus Antibody (2H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRD
Entrez
OMIM
Uniprot