Syntenin 1 Antibody (H00006386-D01P)

Images

 
Western Blot: Syntenin 1 Antibody [H00006386-D01P] - Analysis of SDCBP expression in mouse liver.
Western Blot: Syntenin 1 Antibody [H00006386-D01P] - Analysis of SDCBP expression in transfected 293T cell line by SDCBP polyclonal antibody.Lane 1: SDCBP transfected lysate(32.40 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syntenin 1 Antibody Summary

Immunogen
SDCBP (NP_001007068.1, 1 a.a. - 298 a.a.) full-length human protein. MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
Specificity
Reacts with syndecan binding protein (syntenin).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SDCBP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syntenin 1 Antibody

  • MDA9
  • MDA-9
  • melanoma differentiation associated protein-9
  • Melanoma differentiation-associated protein 9
  • Pro-TGF-alpha cytoplasmic domain-interacting protein 18
  • Scaffold protein Pbp1
  • ST1
  • SYCLTACIP18
  • syndecan binding protein (syntenin)
  • Syndecan-binding protein 1
  • syntenin-1

Background

The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5828
Species: Hu
Applications: WB, ICC, Neut
AF523
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
NBP1-77148
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-835
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
MAB3657
Species: Hu
Applications: CyTOF-ready, ICFlow
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF2560
Species: Hu
Applications: WB
NBP1-84771
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
H00006386-D01P
Species: Hu, Mu
Applications: WB

Publications for Syntenin 1 Antibody (H00006386-D01P) (0)

There are no publications for Syntenin 1 Antibody (H00006386-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntenin 1 Antibody (H00006386-D01P) (0)

There are no reviews for Syntenin 1 Antibody (H00006386-D01P). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Syntenin 1 Antibody (H00006386-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntenin 1 Products

Related Products by Gene

Bioinformatics Tool for Syntenin 1 Antibody (H00006386-D01P)

Discover related pathways, diseases and genes to Syntenin 1 Antibody (H00006386-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntenin 1 Antibody (H00006386-D01P)

Discover more about diseases related to Syntenin 1 Antibody (H00006386-D01P).
 

Pathways for Syntenin 1 Antibody (H00006386-D01P)

View related products by pathway.

PTMs for Syntenin 1 Antibody (H00006386-D01P)

Learn more about PTMs related to Syntenin 1 Antibody (H00006386-D01P).

Blogs on Syntenin 1

There are no specific blogs for Syntenin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntenin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SDCBP
Entrez
Uniprot