SynGAP Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SynGAP Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SynGAP.
  
  

  Source: E. coli

  Amino Acid Sequence: LHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SYNGAP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87841.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SynGAP Recombinant Protein Antigen

• DKFZp761G1421
• KIAA1938135kDa
• MRD5
• synaptic Ras GTPase activating protein 1 homolog (rat)
• synaptic Ras GTPase activating protein 1
• Synaptic Ras-GAP 1

Background

Synaptic Ras GTPase Activating Protein (SynGAP) is a PDZ-domain interacting protein expressed almost exclusively in the brain. SynGAP has been shown to be a major component of postsynaptic density and associates with post synaptic density 95 kDa (PSD-95), a synaptic scaffold protein, and synaptic N-methyl-D-aspartate (NMDA) receptors. SynGAP Ras-GTPase activity has also been shown to be inhibited by phosphorylation by CaM kinase II, another abundant protein located in the postsynaptic density. It has been proposed that SynGAP may function as a negative regulator of MAP Kinase activation in the absence of active NMDA receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYNGAP1