Synaptotagmin 8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Synaptotagmin 8 Antibody [NBP2-30750] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions.
Immunohistochemistry-Paraffin: Synaptotagmin 8 Antibody [NBP2-30750] - Staining of human soft tissue shows cytoplasmic positivity in peripheral nerve.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptotagmin 8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HGWQTMQGRKMGHPPVSPSAPAPAGTTAIPGLIPDLVAGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYT8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Synaptotagmin 8 Protein (NBP2-30750PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptotagmin 8 Antibody

  • DKFZp434K0322
  • Synaptotagmin VIII
  • Synaptotagmin-8
  • SYT8
  • SytVIII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-91297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89676
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20547
Species: Hu
Applications: WB, ICC/IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2568
Species: Mu
Applications: WB, IHC
NBP2-45413
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
NBP2-34068
Species: Hu
Applications: WB, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37536
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready

Publications for Synaptotagmin 8 Antibody (NBP2-30750) (0)

There are no publications for Synaptotagmin 8 Antibody (NBP2-30750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptotagmin 8 Antibody (NBP2-30750) (0)

There are no reviews for Synaptotagmin 8 Antibody (NBP2-30750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Synaptotagmin 8 Antibody (NBP2-30750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptotagmin 8 Products

Bioinformatics Tool for Synaptotagmin 8 Antibody (NBP2-30750)

Discover related pathways, diseases and genes to Synaptotagmin 8 Antibody (NBP2-30750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptotagmin 8 Antibody (NBP2-30750)

Discover more about diseases related to Synaptotagmin 8 Antibody (NBP2-30750).
 

Pathways for Synaptotagmin 8 Antibody (NBP2-30750)

View related products by pathway.

Blogs on Synaptotagmin 8

There are no specific blogs for Synaptotagmin 8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptotagmin 8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYT8
Uniprot