Synapsin I Antibody (4F6)

Images

 
Western Blot: Synapsin I Antibody (4F6) [H00006853-M06] - Analysis of SYN1 expression in A-431 (Cat # L015V1).
Western Blot: Synapsin I Antibody (4F6) [H00006853-M06] - Analysis of SYN1 expression in MCF-7 (Cat # L046V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Synapsin I Antibody (4F6) Summary

Immunogen
SYN1 (NP_008881 362 a.a. - 450 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ
Marker
pre-Synaptic Marker
Specificity
SYN1 (4F6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SYN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Synapsin I Antibody (4F6)

  • SYN1
  • SYN1a
  • SYN1b
  • Synapsin 1
  • Synapsin I
  • synapsin IBrain protein 4.1
  • synapsin-1
  • SYNI

Background

This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-98474
Species: Hu
Applications: WB
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NB120-13258
Species: Mu, Rt
Applications: WB, IP
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
H00006853-M06
Species: Hu
Applications: WB, ELISA

Publications for Synapsin I Antibody (H00006853-M06) (0)

There are no publications for Synapsin I Antibody (H00006853-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synapsin I Antibody (H00006853-M06) (0)

There are no reviews for Synapsin I Antibody (H00006853-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synapsin I Antibody (H00006853-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synapsin I Products

Bioinformatics Tool for Synapsin I Antibody (H00006853-M06)

Discover related pathways, diseases and genes to Synapsin I Antibody (H00006853-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synapsin I Antibody (H00006853-M06)

Discover more about diseases related to Synapsin I Antibody (H00006853-M06).
 

Pathways for Synapsin I Antibody (H00006853-M06)

View related products by pathway.

PTMs for Synapsin I Antibody (H00006853-M06)

Learn more about PTMs related to Synapsin I Antibody (H00006853-M06).

Blogs on Synapsin I.

Synapsin I, a pre-synaptic marker
Synapsin-I, also called Synapsin 1/Syn1, is an ~80 kDa protein (predicted mol. wt. 74.1 kDa) which belongs to the Synapsin family (Synapsin I, Synapsin II, Synapsin III). Synapsins are the evolutionarily conserved phospho-proteins which are associ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synapsin I Antibody (4F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SYN1
Entrez
OMIM
Uniprot