Synapsin 3 Antibody

Images

 
Immunohistochemistry: Synapsin 3 Antibody [NBP1-87519] - Staining of human cerebral cortex shows neutrophil positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synapsin 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SDSSFMANLPNGYMTDLQRPDSSTSSPASPAMERRHPQPLAASFSSPGSSLFSSLSSAMKQAPQATSGLMEPPGPSTPIVQRPRILLVIDDAHTDWSKYFHGKKVNGEIEIRVEQAEFSELNLAAYVTGGCMVDMQVVRN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Synapsin 3 Protein (NBP1-87519PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synapsin 3 Antibody

  • synapsin IIIcN28H9.2 (synapsin III)
  • synapsin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NB120-13258
Species: Mu, Rt
Applications: WB, IP
NBP2-46044
Species: Hu
Applications: WB, IHC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03455
Species: Hu
Applications: WB, ICC/IF
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
29470002
Species: Ce
Applications: ELISA, ICC/IF, IHC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBL1-12547
Species: Hu
NB100-91297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87519
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Synapsin 3 Antibody (NBP1-87519) (0)

There are no publications for Synapsin 3 Antibody (NBP1-87519).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synapsin 3 Antibody (NBP1-87519) (0)

There are no reviews for Synapsin 3 Antibody (NBP1-87519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Synapsin 3 Antibody (NBP1-87519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synapsin 3 Products

Bioinformatics Tool for Synapsin 3 Antibody (NBP1-87519)

Discover related pathways, diseases and genes to Synapsin 3 Antibody (NBP1-87519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synapsin 3 Antibody (NBP1-87519)

Discover more about diseases related to Synapsin 3 Antibody (NBP1-87519).
 

Pathways for Synapsin 3 Antibody (NBP1-87519)

View related products by pathway.

PTMs for Synapsin 3 Antibody (NBP1-87519)

Learn more about PTMs related to Synapsin 3 Antibody (NBP1-87519).
 

Research Areas for Synapsin 3 Antibody (NBP1-87519)

Find related products by research area.

Blogs on Synapsin 3

There are no specific blogs for Synapsin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synapsin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYN3