SYCE1 Antibody - BSA Free

Western Blot: SYCE1 Antibody [NBP2-85848] - Host: Rabbit. Target Name: SYCE1. Sample Tissue: Mouse Lung lysates. Antibody Dilution: 1ug/ml

Product Discontinued

SYCE1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse SYCE1. Peptide sequence: QHEQLQQRCHQLQQKRQRLKEELEKHGVQILAHSTQNEEDSSWRMASPKP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYCE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SYCE1 Antibody - BSA Free

• synaptonemal complex central element protein 1

Background

Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologouschromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have arole in the synaptonemal complexe assembly, stabilization and recombination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYCE1