SUSD6 Antibody - BSA Free

Western Blot: KIAA0247 Antibody [NBP1-62569] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SUSD6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to KIAA0247(KIAA0247) The peptide sequence was selected form the N terminal of KIAA0247. Peptide sequence YLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIAA0247
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SUSD6 Antibody - BSA Free

• hypothetical protein LOC9766
• KIAA0247

Background

KIAA0247 is a single-pass type I membrane protein. It contains 1 Sushi (CCP/SCR) domain. The function of the KIAA0247 protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIAA0247
• OMIM:
  • NP_055549(Human)
• Uniprot:
  • Q92537(Human)