![Immunohistochemistry-Paraffin: SUSD3 Antibody [NBP1-82723] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/SUSD3-Antibody-Immunohistochemistry-Paraffin-NBP1-82723-img0001.jpg "Immunohistochemistry-Paraffin: SUSD3 Antibody [NBP1-82723] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SUSD3 Antibody - BSA Free (NBP1-82723) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUSD3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot ZAG Antibody [Unconjugated]](https://images.novusbio.com/images2/ZAG_AF4764_Western_Blot_5541.jpg)
![Immunohistochemistry ZAG Antibody [Unconjugated]](https://images.novusbio.com/images2/ZAG_AF4764_Immunohistochemistry_11702.jpg)
![Immunocytochemistry ZAG Antibody [Unconjugated]](https://images.novusbio.com/images2/ZAG_AF4764_Immunocytochemistry__Immunofluorescence_20270.jpg)
![Western Blot Serpin A11 Antibody (895842) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A11_MAB8236_Western_Blot_14887.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 01/26/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for SUSD3 Antibody (NBP1-82723)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUSD3 |
![Immunohistochemistry Stanniocalcin 2/STC-2 Antibody [Unconjugated]](https://images.novusbio.com/images/af2830_human-stanniocalcin-2-stc-2-affinity-purified-polyclonal-ab-41202412394936.jpg)
![Immunohistochemistry Stanniocalcin 2/STC-2 Antibody [Unconjugated]](https://images.novusbio.com/images/af2830_human-stanniocalcin-2-stc-2-affinity-purified-polyclonal-ab-41202412394922.jpg)
![Immunocytochemistry S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry_6489.jpg)
![Western Blot S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry__Immunofluorescence_17308.jpg)
![Simple Western S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Simple_Western_18694.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
