SUR1/SUR2B Antibody (S323A-31)

Product Discontinued

SUR1/SUR2B Antibody (S323A-31) Summary

• Immunogen: Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B
• Localization: Membrane
• Specificity: Detects approx 175kDa and smaller fragments likely due to proteolytic cleavage.
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: ABCC9
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:100
  • Western Blot 1ug/ml
• Application Notes: 1 ug/ml of SUR1 and SUR2B Antibody was sufficient for detection of SUR1 and SUR2B in 20 ug of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary Antibody.

Reactivity Notes

Based on homology predicted to detect mouse.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4) and 50% Glycerol
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein G purified

Alternate Names for SUR1/SUR2B Antibody (S323A-31)

• ABC37
• ATFB12
• ATP Binding Cassette Subfamily C Member 9
• ATP-Binding Cassette, Sub-Family C (CFTR/MRP)
• CANTU
• CMD1O
• EC 3.6.3.44
• member 9
• Sulfonylurea receptor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCC9
• Uniprot:
  • Q63563(Rat)