Recombinant Human Supervillin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Supervillin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1679-1786 of Human SVIL partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SVIL
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Supervillin Protein

  • Archvillin
  • DKFZp686A17191
  • membrane-associated F-actin binding protein p205
  • p205/p250
  • Supervillin
  • SVIL

Background

SVIL - supervillin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-90117
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89021
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5626
Species: Hu
Applications: WB, ICC
NBP1-87947
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for Supervillin Partial Recombinant Protein (H00006840-Q01) (0)

There are no publications for Supervillin Partial Recombinant Protein (H00006840-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Supervillin Partial Recombinant Protein (H00006840-Q01) (0)

There are no reviews for Supervillin Partial Recombinant Protein (H00006840-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Supervillin Partial Recombinant Protein (H00006840-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Supervillin Products

Bioinformatics Tool for Supervillin Partial Recombinant Protein (H00006840-Q01)

Discover related pathways, diseases and genes to Supervillin Partial Recombinant Protein (H00006840-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Supervillin Partial Recombinant Protein (H00006840-Q01)

Discover more about diseases related to Supervillin Partial Recombinant Protein (H00006840-Q01).
 

Pathways for Supervillin Partial Recombinant Protein (H00006840-Q01)

View related products by pathway.

PTMs for Supervillin Partial Recombinant Protein (H00006840-Q01)

Learn more about PTMs related to Supervillin Partial Recombinant Protein (H00006840-Q01).

Blogs on Supervillin

There are no specific blogs for Supervillin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Supervillin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SVIL
Entrez