SUMO-interacting Motif (SIM) Antibody

Images

 
Western Blot: SUMO-interacting Motif (SIM) Antibody [NBP2-30700] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SUMO-interacting Motif (SIM) Antibody [NBP2-30700] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.
Immunohistochemistry-Paraffin: SUMO-interacting Motif (SIM) Antibody [NBP2-30700] - Staining of human kidney shows cytoplasmic positivity in cells in tubules and in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUMO-interacting Motif (SIM) Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MKIQQLHPANAKTVEWDWKLLTYVMEEEGQTLPGRVLFLRYVVQTLEDDFQQTLRRQRQHLQQSIANMVLSCDKQPHNVRDVIKWLVKA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIMC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SUMO-interacting Motif (SIM) Protein (NBP2-30700PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUMO-interacting Motif (SIM) Antibody

  • Chromosome 5 Open Reading Frame 25
  • Oocyte Maturation Associated 1
  • OOMA1
  • Platform Element For Inhibition Of Autolytic Degradation
  • PLEIAD
  • SIMC1
  • SUMOinteracting Motif
  • SUMO-interacting Motif
  • SUMO-Interacting Motif-Containing Protein 1
  • SUMO-Interacting Motifs Containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90442
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006047-A01
Species: Hu
Applications: WB, ELISA
NB500-218
Species: Hu, Mu
Applications: WB
NBP2-38473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SUMO-interacting Motif (SIM) Antibody (NBP2-30700) (0)

There are no publications for SUMO-interacting Motif (SIM) Antibody (NBP2-30700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUMO-interacting Motif (SIM) Antibody (NBP2-30700) (0)

There are no reviews for SUMO-interacting Motif (SIM) Antibody (NBP2-30700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUMO-interacting Motif (SIM) Antibody (NBP2-30700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUMO-interacting Motif (SIM) Products

Bioinformatics Tool for SUMO-interacting Motif (SIM) Antibody (NBP2-30700)

Discover related pathways, diseases and genes to SUMO-interacting Motif (SIM) Antibody (NBP2-30700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SUMO-interacting Motif (SIM)

There are no specific blogs for SUMO-interacting Motif (SIM), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUMO-interacting Motif (SIM) Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIMC1
Uniprot