SOBP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SOBP Antibody [NBP1-90442] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles.
Immunohistochemistry-Paraffin: SOBP Antibody [NBP1-90442] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVPIIVPLIPPPFIKPPAEDDVSNVQIMCAWCQKVGIKRYSLSMGSEVKSFCSEKCFAACRRAYFKRNKARDEDGHAENFPQQH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SOBP Protein (NBP1-90442PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SOBP Antibody

  • jackson circler protein 1
  • sine oculis binding protein homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-54633
Species: Hu
Applications: WB, IHC
NBP2-57880
Species: Hu
Applications: ICC/IF
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-218
Species: Hu, Mu
Applications: WB

Publications for SOBP Antibody (NBP1-90442) (0)

There are no publications for SOBP Antibody (NBP1-90442).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOBP Antibody (NBP1-90442) (0)

There are no reviews for SOBP Antibody (NBP1-90442). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SOBP Antibody (NBP1-90442) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOBP Products

SOBP NBP1-90442

Bioinformatics Tool for SOBP Antibody (NBP1-90442)

Discover related pathways, diseases and genes to SOBP Antibody (NBP1-90442). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOBP Antibody (NBP1-90442)

Discover more about diseases related to SOBP Antibody (NBP1-90442).
 

Pathways for SOBP Antibody (NBP1-90442)

View related products by pathway.

PTMs for SOBP Antibody (NBP1-90442)

Learn more about PTMs related to SOBP Antibody (NBP1-90442).

Blogs on SOBP

There are no specific blogs for SOBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOBP