Recombinant Human STX10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human STX10 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 137-219 of Human STX10 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
STX10

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STX10 Protein

  • Syn10
  • SYN10hsyn10
  • syntaxin 10
  • syntaxin-10

Background

STX10 - syntaxin 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92467
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89788
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5664
Species: Hu
Applications: WB, IHC, ICC
NBP1-86985
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15131
Species: Hu
Applications: WB
NB300-621
Species: Hu, Rt, Bv, Ca, Ha, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IM, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45413
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP2-24664
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
H00008677-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for STX10 Partial Recombinant Protein (H00008677-Q01) (0)

There are no publications for STX10 Partial Recombinant Protein (H00008677-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STX10 Partial Recombinant Protein (H00008677-Q01) (0)

There are no reviews for STX10 Partial Recombinant Protein (H00008677-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STX10 Partial Recombinant Protein (H00008677-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STX10 Products

Bioinformatics Tool for STX10 Partial Recombinant Protein (H00008677-Q01)

Discover related pathways, diseases and genes to STX10 Partial Recombinant Protein (H00008677-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STX10 Partial Recombinant Protein (H00008677-Q01)

Discover more about diseases related to STX10 Partial Recombinant Protein (H00008677-Q01).
 

Pathways for STX10 Partial Recombinant Protein (H00008677-Q01)

View related products by pathway.

Blogs on STX10

There are no specific blogs for STX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Glut4 Antibody
NBP1-49533
STX10 Antibody
NBP1-81663
TGN46 Antibody
NBP1-49643

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STX10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STX10