STOML3 Antibody


Western Blot: STOML3 Antibody [NBP1-69232] - This Anti-STOML3 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

STOML3 Antibody Summary

Synthetic peptides corresponding to STOML3(stomatin (EPB72)-like 3) The peptide sequence was selected from the N terminal of STOML3. Peptide sequence SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against STOML3 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for STOML3 Antibody

  • Epb7.2l
  • erythrocyte band 7 integral membrane protein
  • SLP-3
  • SROprotein 7.2B
  • stomatin (EPB72)-like 3
  • stomatin-like protein 3


The specific function of the protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for STOML3 Antibody (NBP1-69232) (0)

There are no publications for STOML3 Antibody (NBP1-69232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STOML3 Antibody (NBP1-69232) (0)

There are no reviews for STOML3 Antibody (NBP1-69232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STOML3 Antibody (NBP1-69232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional STOML3 Products

Bioinformatics Tool for STOML3 Antibody (NBP1-69232)

Discover related pathways, diseases and genes to STOML3 Antibody (NBP1-69232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STOML3 Antibody (NBP1-69232)

Discover more about diseases related to STOML3 Antibody (NBP1-69232).

Pathways for STOML3 Antibody (NBP1-69232)

View related products by pathway.

Blogs on STOML3

There are no specific blogs for STOML3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our STOML3 Antibody and receive a gift card or discount.


Gene Symbol STOML3