STK4 Antibody (4F4)

Images

 
Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4. Analysis of STK4 expression in Raw 264.7.
Immunocytochemistry/ Immunofluorescence: STK4 Antibody (4F4) [H00006789-M02] - Analysis of monoclonal antibody to STK4 on HeLa cell. Antibody concentration 25 ug/ml.
Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4 Analysis of STK4 expression in HeLa.
Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4. Analysis of STK4 expression in PC-12.
Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4. Analysis of STK4 expression in NIH/3T3.
Proximity Ligation Assay: STK4 Antibody (4F4) [H00006789-M02] - Analysis of protein-protein interactions between TP53 and STK4. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-STK4 ...read more
ELISA: STK4 Antibody (4F4) [H00006789-M02] - Detection limit for recombinant GST tagged STK4 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA
Clone
4F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

STK4 Antibody (4F4) Summary

Immunogen
STK4 (NP_006273 391 a.a. - 485 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ
Specificity
STK4 - serine/threonine kinase 4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STK4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Positive Control
STK4 Lysate (NBP2-66194)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STK4 Antibody (4F4)

  • EC 2.7.11
  • EC 2.7.11.1
  • kinase responsive to stress 2
  • KRS2KRS2))
  • Mammalian STE20-like protein kinase 1
  • mammalian sterile 20-like 1
  • MST-1
  • MST1DKFZp686A2068
  • serine/threonine kinase 4
  • serine/threonine-protein kinase 4
  • Serine/threonine-protein kinase Krs-2
  • STE20-like kinase MST1

Background

The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00060485-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF5066
Species: Hu
Applications: WB
NBP1-82617
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-33860
Species: Hu
Applications: WB, IHC, IHC-P
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-197
Species: Hu, Mu
Applications: WB, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-66121
Species: Hu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for STK4 Antibody (H00006789-M02) (0)

There are no publications for STK4 Antibody (H00006789-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK4 Antibody (H00006789-M02) (0)

There are no reviews for STK4 Antibody (H00006789-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STK4 Antibody (H00006789-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional STK4 Products

Bioinformatics Tool for STK4 Antibody (H00006789-M02)

Discover related pathways, diseases and genes to STK4 Antibody (H00006789-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK4 Antibody (H00006789-M02)

Discover more about diseases related to STK4 Antibody (H00006789-M02).
 

Pathways for STK4 Antibody (H00006789-M02)

View related products by pathway.

PTMs for STK4 Antibody (H00006789-M02)

Learn more about PTMs related to STK4 Antibody (H00006789-M02).
 

Research Areas for STK4 Antibody (H00006789-M02)

Find related products by research area.

Blogs on STK4

There are no specific blogs for STK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STK4 Antibody (4F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol STK4
Entrez
OMIM
Uniprot