STK4 Antibody (1D7-8A10)

Western Blot: STK4 Antibody (1D7-8A10) [H00006789-M01] - STK4 monoclonal antibody (M01), clone 1D7-8A10 Analysis of STK4 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: STK4 Antibody (1D7-8A10) [H00006789-M01] - Analysis of monoclonal antibody to STK4 on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: STK4 Antibody (1D7-8A10) [H00006789-M01] - Analysis of monoclonal antibody to STK4 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. Antibody concentration 5 ug/ml.

ELISA: STK4 Antibody (1D7-8A10) [H00006789-M01] - Detection limit for recombinant GST tagged STK4 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, Func, ICC/IF, IHC
• Clone: 1D7-8A10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

STK4 Antibody (1D7-8A10) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: STK4 (AAH05231, 1 a.a. ~ 39 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG
• Specificity: STK4 - serine/threonine kinase 4
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: STK4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STK4 Antibody (1D7-8A10)

• EC 2.7.11
• EC 2.7.11.1
• kinase responsive to stress 2
• KRS2KRS2))
• Mammalian STE20-like protein kinase 1
• mammalian sterile 20-like 1
• MST-1
• MST1DKFZp686A2068
• serine/threonine kinase 4
• serine/threonine-protein kinase 4
• Serine/threonine-protein kinase Krs-2
• STE20-like kinase MST1

Background

The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for STK4 Antibody (H00006789-M01)(2)

Publications using H00006789-M01

• Portela A, Pelaez E, Calvo-Lozano O et al. Label-Free Nanoplasmonic Biosensing of Cancer Biomarkers for Clinical Diagnosis. Methods Mol Biol. 2019-07-16 [PMID: 31309477]
• Servas C, Kiehlmeier S, Hach J et al. The mammalian STE20-like kinase 1 (MST1) is a substrate for the apoptosis inhibiting protein kinase CK2. Cell Signal 2017-05-06 [PMID: 28487119]

Bioinformatics

• Gene Symbol: STK4
• Entrez:
  • 6789(Human)
• OMIM:
  • 604965(Human)
• Uniprot:
  • AAH05231(Human)