STK33 Antibody

Images

 
Immunohistochemistry: STK33 Antibody [NBP1-86069] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STK33 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETETKWAIK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK33
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STK33 Protein (NBP1-86069PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STK33 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine kinase 33
  • serine/threonine-protein kinase 33

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-37262
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-37428
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-82539
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32343
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30922
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00051765-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00056899-P01
Species: Hu
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF6028
Species: Hu
Applications: WB, IHC

Publications for STK33 Antibody (NBP1-86069) (0)

There are no publications for STK33 Antibody (NBP1-86069).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK33 Antibody (NBP1-86069) (0)

There are no reviews for STK33 Antibody (NBP1-86069). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STK33 Antibody (NBP1-86069) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STK33 Products

Bioinformatics Tool for STK33 Antibody (NBP1-86069)

Discover related pathways, diseases and genes to STK33 Antibody (NBP1-86069). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK33 Antibody (NBP1-86069)

Discover more about diseases related to STK33 Antibody (NBP1-86069).
 

Pathways for STK33 Antibody (NBP1-86069)

View related products by pathway.

PTMs for STK33 Antibody (NBP1-86069)

Learn more about PTMs related to STK33 Antibody (NBP1-86069).
 

Research Areas for STK33 Antibody (NBP1-86069)

Find related products by research area.

Blogs on STK33

There are no specific blogs for STK33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STK33 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK33