Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, PA, AP |
Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 54-152 of Human STK11IP Source: Wheat Germ Amino Acid Sequence: HVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPLHCLHGLRGIYSQLETLICSRS |
Details of Functionality | This protein is not active and should not be used for experiments requiring activity. |
Source | Wheat germ |
Protein/Peptide Type | Partial Recombinant Protein |
Gene | STK11IP |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Application Notes | This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells. |
Theoretical MW | 36.63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -80C. Avoid freeze-thaw cycles. |
Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Diseases for STK11IP Partial Recombinant Protein (H00114790-Q01)Discover more about diseases related to STK11IP Partial Recombinant Protein (H00114790-Q01).
| Pathways for STK11IP Partial Recombinant Protein (H00114790-Q01)View related products by pathway.
|
PTMs for STK11IP Partial Recombinant Protein (H00114790-Q01)Learn more about PTMs related to STK11IP Partial Recombinant Protein (H00114790-Q01).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | STK11IP |