Recombinant Human STK11IP Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human STK11IP Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 54-152 of Human STK11IP

Source: Wheat Germ

Amino Acid Sequence: HVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPLHCLHGLRGIYSQLETLICSRS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
STK11IP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STK11IP Protein

  • KIAA1898LKB1 interacting protein
  • LIP1serine/threonine kinase 11-interacting protein
  • LKB1-interacting protein 1
  • LKB1IPserine/threonine-protein kinase 11-interacting protein
  • serine/threonine kinase 11 interacting protein
  • STK11IP1STK11 interacting protein

Background

STK11IP - serine/threonine kinase 11 interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13611
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91270
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
NB100-2320
Species: Hu
Applications: IP (-), WB, IP
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-22514
Species: Hu, Mu
Applications: WB (-), WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88502
Species: Hu
Applications: IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-92067
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005655-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2769
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-856
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA

Publications for STK11IP Partial Recombinant Protein (H00114790-Q01) (0)

There are no publications for STK11IP Partial Recombinant Protein (H00114790-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK11IP Partial Recombinant Protein (H00114790-Q01) (0)

There are no reviews for STK11IP Partial Recombinant Protein (H00114790-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STK11IP Partial Recombinant Protein (H00114790-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for STK11IP Partial Recombinant Protein (H00114790-Q01)

Discover related pathways, diseases and genes to STK11IP Partial Recombinant Protein (H00114790-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK11IP Partial Recombinant Protein (H00114790-Q01)

Discover more about diseases related to STK11IP Partial Recombinant Protein (H00114790-Q01).
 

Pathways for STK11IP Partial Recombinant Protein (H00114790-Q01)

View related products by pathway.

PTMs for STK11IP Partial Recombinant Protein (H00114790-Q01)

Learn more about PTMs related to STK11IP Partial Recombinant Protein (H00114790-Q01).

Blogs on STK11IP

There are no specific blogs for STK11IP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

STK11IP Antibody
NBP1-92451
COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STK11IP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STK11IP