Home » STK11IP » STK11IP Proteins » Recombinant Human STK11IP Protein

Recombinant Human STK11IP Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human STK11IP Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 54-152 of Human STK11IP

Source: Wheat Germ

Amino Acid Sequence: HVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPLHCLHGLRGIYSQLETLICSRS
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
STK11IP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STK11IP Protein

  • KIAA1898LKB1 interacting protein
  • LIP1serine/threonine kinase 11-interacting protein
  • LKB1-interacting protein 1
  • LKB1IPserine/threonine-protein kinase 11-interacting protein
  • serine/threonine kinase 11 interacting protein
  • STK11IP1STK11 interacting protein

Background

STK11IP - serine/threonine kinase 11 interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LKB1/STK11 Antibody
NBP2-14835
Western Blot: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in human testes lysate.
Immunocytochemistry/Immunofluorescence: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in HepG2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in mouse stomach using DAB with hematoxylin counterstain.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Annexin A2 Antibody
NBP1-31310
Western Blot: Annexin A2 Antibody [NBP1-31310] - Wild-type (WT) and Annexin II knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Annexin II antibody [N1], N-term. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Annexin A2 Antibody [NBP1-31310] - Confocal immunofluorescence analysis (Olympus FV10i) of paraformaldehyde-fixed HeLa, using Annexin A2 Antibody antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled Red.
Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP1-31310] - Analysis of paraffin-embedded Human pancreas tissue, using ANXA2 antibody at 1:100 dilution.
(4 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MRPL17 Antibody
NBP2-13611
Western Blot: MRPL17 Antibody [NBP2-13611] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: MRPL17 Antibody [NBP2-13611] - Staining of human breast shows strong cytoplasmic positivity in granular pattern glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
ZNF521 Antibody
NBP1-91270
Immunocytochemistry/Immunofluorescence: ZNF521 Antibody [NBP1-91270] - Zfp521 antibody was tested in U2OS cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: ZNF521 Antibody [NBP1-91270] - IHC analysis of ZFP521 in mouse epidermis using DAB with hematoxylin counterstain.
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(10 Publications)
Species: Hu
SMG1 Antibody
NB100-2320
Western Blot: SMG1 Antibody [NB100-2320] - Detection of Human SMG1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SMG1 antibody NB100-2320 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: SMG1 Antibody [NB100-2320] - Detection of Human SMG1 on HeLa whole cell lysate using NB100-2320. IP of SMG1 was successful when using affinity purified rabbit anti-SMG1 antibodies NB100-2321 and another SMG1 antibody.
(3 Publications)
Species: Hu
Applications: IP (-), WB, IP
Smad4 Antibody
[Unconjugated]
AF2097
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, Jurkat human acute T cell leukemia cell line, and K562 human chronic myelogenous leukemia cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Smad4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2097) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Smad4 at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Jurkat human acute T cell leukemia cell line treated with 10 ng/mL Recombinant Human IL‑12 (Catalog # 219-IL) overnight was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Smad4/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Smad4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2097) or control antibody (Catalog # AB‑108‑C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The p21 promoter was detected by standard PCR.
Smad4 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Goat Anti-Human Smad4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2097) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Review)
(3 Publications)
Species: Hu
Applications: WB, ChIP, ICC
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody.
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded human colon carcinoma stained with COX2 antibody.
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded human colon carcinoma stained with COX2 antibody.
(1 Review)
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Cytohesin 2
Antibody (10A12)
NBP2-22514
Immunocytochemistry/Immunofluorescence: Cytohesin 2 Antibody (10A12) [NBP2-22514] - Analysis of Cytohesin 2 in NIH-3T3 Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a Cytohesin 2 monoclonal antibody at a dilution of 1:100 overnight at 4C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody. Cytohesin 2 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.
Immunohistochemistry-Paraffin: Cytohesin 2 Antibody (10A12) [NBP2-22514] - Normal biopsies of deparaffinized Human stomach tissue.
Immunocytochemistry/Immunofluorescence: Cytohesin 2 Antibody (10A12) [NBP2-22514] - Analysis of Cytohesin 2 in HeLa Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a Cytohesin 2 monoclonal antibody at a dilution of 1:100 overnight at 4C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody. Cytohesin 2 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.
Species: Hu, Mu
Applications: WB (-), WB, Flow, ICC/IF, IHC, IHC-P, IP
Carboxyl Ester
Lipase/CEL Antibody
NBP1-88502
Immunohistochemistry-Paraffin: Carboxyl Ester Lipase/CEL Antibody [NBP1-88502] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: Carboxyl Ester Lipase/CEL Antibody [NBP1-88502] - Staining of human lactating breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Carboxyl Ester Lipase/CEL Antibody [NBP1-88502] - Staining of human liver shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
MCG10 Antibody
NBP1-76729
Western Blot: MCG10 Antibody [NBP1-76729] - HeLa cell lysate with MCG10 antibody at (A) 0.5, (B) 1 and (C) 2 u/mL.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - HeLa cells with MCG10 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - Hela cells.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
COP1 Antibody (1E4)
H00064326-M01
Western Blot: COP1 Antibody (1E4) [H00064326-M01] - RFWD2 monoclonal antibody (M01), clone 1E4 Analysis of RFWD2 expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: COP1 Antibody (1E4) [H00064326-M01] - Analysis of monoclonal antibody to RFWD2 on NIH/3T3 cell. Antibody concentration 10 ug/ml.
Western Blot: COP1 Antibody (1E4) [H00064326-M01] - RFWD2 monoclonal antibody (M01), clone 1E4. Analysis of RFWD2 expression in A-431.
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
LASS1 Antibody
NBP1-92067
Immunocytochemistry/Immunofluorescence: LASS1 Antibody [NBP1-92067] - Staining of human cell line U-251 MG shows positivity in cytoplasm and centrosome.
Immunohistochemistry-Paraffin: LASS1 Antibody [NBP1-92067] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Recombinant Human
CCL4L1/LAG-1 Protein
NBP2-34929
SDS-Page: Human CCL4L1/LAG-1 Protein [NBP2-34929]
Species: Hu
Kallikrein 10
Antibody
AF2007
Kallikrein 10 Antibody
(1 Publication)
Species: Hu
Applications: WB
IL-31 RA Antibody
[Unconjugated]
AF2769
IL‑31 RA was detected in immersion fixed K562 human chronic myelogenous leukemia cell line using Goat Anti-Human IL‑31 RA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2769) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
IL‑31 RA was detected in immersion fixed THP‑1 human acute monocytic leukemia cell line using Goat Anti-Human IL‑31 RA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2769) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
U937 human histiocytic lymphoma cell line was stained with Goat Anti-Human IL‑31 RA Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF2769, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histo­gram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
(3 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
COP Antibody
H00114769-B01P
Western Blot: COP Antibody [H00114769-B01P] - Analysis of CARD16 expression in transfected 293T cell line by CARD16 polyclonal antibody. Lane 1: COP1 transfected lysate(10.67 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: COP Antibody [H00114769-B01P] - Analysis of purified antibody to COP1 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ELISA, ICC/IF
beta-NGF
[Unconjugated]
256-GF/CF
1 µg/lane of Recombinant Human beta -NGF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human beta -NGF (Catalog # 256‑GF/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.2-2 ng/mL.
(22 Publications)
Species: Hu

Publications for STK11IP Partial Recombinant Protein (H00114790-Q01) (0)

There are no publications for STK11IP Partial Recombinant Protein (H00114790-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK11IP Partial Recombinant Protein (H00114790-Q01) (0)

There are no reviews for STK11IP Partial Recombinant Protein (H00114790-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STK11IP Partial Recombinant Protein (H00114790-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STK11IP Products

Bioinformatics Tool for STK11IP Partial Recombinant Protein (H00114790-Q01)

Discover related pathways, diseases and genes to STK11IP Partial Recombinant Protein (H00114790-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK11IP Partial Recombinant Protein (H00114790-Q01)

Discover more about diseases related to STK11IP Partial Recombinant Protein (H00114790-Q01).
 

Pathways for STK11IP Partial Recombinant Protein (H00114790-Q01)

View related products by pathway.

PTMs for STK11IP Partial Recombinant Protein (H00114790-Q01)

Learn more about PTMs related to STK11IP Partial Recombinant Protein (H00114790-Q01).

Blogs on STK11IP

There are no specific blogs for STK11IP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

STK11IP Recombinant Protein Antigen
NBP2-58347PEP
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody.
COX-2 Antibody
NB100-689
Immunocytochemistry/Immunofluorescence: STK11IP Antibody [NBP1-92451] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
STK11IP Antibody
NBP1-92451
1 µg/lane of Recombinant Human beta -NGF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
beta-NGF [Unconjugated]
256-GF-100/CF

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STK11IP Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol STK11IP