Recombinant Human ST3GAL3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ST3GAL3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-390 of Human ST3GAL3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSSKYSHSSSPQEKPVADSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ST3GAL3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ST3GAL3 Protein

  • alpha 2,3-sialyltransferase III
  • Alpha 2,3-ST 3
  • alpha-2,3-sialyltransferase II
  • Beta-galactoside alpha-2,3-sialyltransferase 3
  • CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
  • EC 2.4.99.6
  • Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase
  • Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase
  • N-acetyllactosaminide alpha-2,3-sialyltransferase
  • Sialyltransferase 6
  • SIAT6sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase)
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  • ST3Gal III
  • ST3GALII
  • ST3GalIII
  • ST3N

Background

The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5924
Species: Hu
Applications: WB, Simple Western
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF7275
Species: Hu, Mu, Rt
Applications: WB
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55006
Species: Hu
Applications: ICC/IF
AF5316
Species: Hu
Applications: WB
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB64091
Species: Hu
Applications: WB, ICC
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NBP2-20492
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38252
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00006487-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ST3GAL3 Recombinant Protein (H00006487-P01) (0)

There are no publications for ST3GAL3 Recombinant Protein (H00006487-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST3GAL3 Recombinant Protein (H00006487-P01) (0)

There are no reviews for ST3GAL3 Recombinant Protein (H00006487-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST3GAL3 Recombinant Protein (H00006487-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ST3GAL3 Products

Bioinformatics Tool for ST3GAL3 Recombinant Protein (H00006487-P01)

Discover related pathways, diseases and genes to ST3GAL3 Recombinant Protein (H00006487-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST3GAL3 Recombinant Protein (H00006487-P01)

Discover more about diseases related to ST3GAL3 Recombinant Protein (H00006487-P01).
 

Pathways for ST3GAL3 Recombinant Protein (H00006487-P01)

View related products by pathway.

PTMs for ST3GAL3 Recombinant Protein (H00006487-P01)

Learn more about PTMs related to ST3GAL3 Recombinant Protein (H00006487-P01).

Blogs on ST3GAL3

There are no specific blogs for ST3GAL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ST3GAL3 Antibody
NBP2-20491
COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ST3GAL3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ST3GAL3