SSX5 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-229 of human SSX5 (NP_066295.3). MNGDDAFVRRPRVGSQIPEKMQKHPWRQVCDRGIHLVNLSPFWKVGREPASSIKALLCGRGEARAFDDIAKYFSEKEWEKMKASEKIIYVYMKRKYEAMTKLGFKATLPPFMRNKRVADFQGNDFDNDPNRGNQVEHPQMTFGRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYEEISDPQEDDE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SSX5 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:200 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for SSX5 Antibody - BSA Free
Background
The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation. Two transcript variants encoding distinct isoforms have been identified for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: ICC/IF, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Publications for SSX5 Antibody (NBP2-94878) (0)
There are no publications for SSX5 Antibody (NBP2-94878).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SSX5 Antibody (NBP2-94878) (0)
There are no reviews for SSX5 Antibody (NBP2-94878).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SSX5 Antibody (NBP2-94878) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SSX5 Products
Research Areas for SSX5 Antibody (NBP2-94878)
Find related products by research area.
|
Blogs on SSX5