Recombinant Human SSX3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SSX3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-188 of Human SSX3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SSX3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00010214-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SSX3 Protein

  • CT5.3Cancer/testis antigen 5.3
  • MGC119054
  • MGC14495
  • protein SSX3
  • synovial sarcoma, X breakpoint 3

Background

The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006757-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-00614
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
H00006759-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01842
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
H00117177-B01P
Species: Hu, Ze
Applications: WB, ELISA
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-83705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80180
Species: Hu
Applications: WB
NBP1-79469
Species: Hu
Applications: WB
AF470
Species: Mu
Applications: WB, IHC, Neut
NBP1-79468
Species: Hu
Applications: WB
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89329
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00057799-T01
Species: Hu

Publications for SSX3 Recombinant Protein (H00010214-P01)(1)

Reviews for SSX3 Recombinant Protein (H00010214-P01) (0)

There are no reviews for SSX3 Recombinant Protein (H00010214-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSX3 Recombinant Protein (H00010214-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SSX3 Products

Bioinformatics Tool for SSX3 Recombinant Protein (H00010214-P01)

Discover related pathways, diseases and genes to SSX3 Recombinant Protein (H00010214-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSX3 Recombinant Protein (H00010214-P01)

Discover more about diseases related to SSX3 Recombinant Protein (H00010214-P01).
 

Pathways for SSX3 Recombinant Protein (H00010214-P01)

View related products by pathway.

PTMs for SSX3 Recombinant Protein (H00010214-P01)

Learn more about PTMs related to SSX3 Recombinant Protein (H00010214-P01).

Blogs on SSX3

There are no specific blogs for SSX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SSX3 Antibody (4A11)
H00010214-M03
ErbB2/Her2
1129-ER-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SSX3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SSX3