SSH3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SSH3 Antibody [NBP1-83805] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & actin filaments.

Immunohistochemistry-Paraffin: SSH3 Antibody [NBP1-83805] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SSH3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MKQYECSLEQALRHVQELRPIARPNPGFLRQLQIYQGILTASRQSHVWEQKVGGVSPEEHPAPEVSTPFPPLPPEPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSH3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SSH3 Protein (NBP1-83805PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SSH3 Antibody - BSA Free

• EC 3.1.3.16
• EC 3.1.3.48
• FLJ10928
• FLJ20515
• FLJ42240
• hSSH-3L
• protein phosphatase Slingshot homolog 3
• slingshot 3
• slingshot homolog 3 (Drosophila)
• SSH3
• SSH3L
• SSH-3L
• SSH-like protein 3

Background

The ADF (actin-depolymerizing factor)/cofilin family (see MIM 601442) is composed of stimulus-responsive mediators of actin dynamics. ADF/cofilin proteins are inactivated by kinases such as LIM domain kinase-1 (LIMK1; MIM 601329). The SSH family appears to play a role in actin dynamics by reactivating ADF/cofilin proteins in vivo (Niwa et al., 2002 [PubMed 11832213]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SSH3