SSH3 Antibody

Images

 
Immunohistochemistry-Paraffin: SSH3 Antibody [NBP1-83804] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SSH3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEASSEPTEKAPSEEELHGDQTDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAPRPPRLRY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SSH3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SSH3 Protein (NBP1-83804PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SSH3 Antibody

  • EC 3.1.3.16
  • EC 3.1.3.48
  • FLJ10928
  • FLJ20515
  • FLJ42240
  • hSSH-3L
  • protein phosphatase Slingshot homolog 3
  • slingshot 3
  • slingshot homolog 3 (Drosophila)
  • SSH3
  • SSH3L
  • SSH-3L
  • SSH-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52568
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC
NBP2-49245
Species: Hu
Applications: IHC
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
H00003984-M01A
Species: Hu, Mu, Rt
Applications: WB, ELISA, IF

Publications for SSH3 Antibody (NBP1-83804) (0)

There are no publications for SSH3 Antibody (NBP1-83804).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSH3 Antibody (NBP1-83804) (0)

There are no reviews for SSH3 Antibody (NBP1-83804). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SSH3 Antibody (NBP1-83804) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SSH3 Products

Bioinformatics Tool for SSH3 Antibody (NBP1-83804)

Discover related pathways, diseases and genes to SSH3 Antibody (NBP1-83804). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSH3 Antibody (NBP1-83804)

Discover more about diseases related to SSH3 Antibody (NBP1-83804).
 

Pathways for SSH3 Antibody (NBP1-83804)

View related products by pathway.

PTMs for SSH3 Antibody (NBP1-83804)

Learn more about PTMs related to SSH3 Antibody (NBP1-83804).

Blogs on SSH3

There are no specific blogs for SSH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSH3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSH3