Recombinant Human SSH1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SSH1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 752-849 of Human SSH1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPAS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SSH1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SSH1 Protein

  • EC 3.1.3.16
  • EC 3.1.3.48
  • FLJ21928
  • hSSH-1L
  • KIAA1298FLJ38102
  • protein phosphatase Slingshot homolog 1
  • slingshot 1
  • slingshot homolog 1 (Drosophila)
  • SSH1L
  • SSH-1L
  • SSH-like protein 1

Background

The ADF (actin-depolymerizing factor)/cofilin family (see MIM 601442) is composed of stimulus-responsive mediators of actin dynamics. ADF/cofilin proteins are inactivated by kinases such as LIM domain kinase-1 (LIMK1; MIM 601329). The SSH family appears to play a role in actin dynamics by reactivating ADF/cofilin proteins in vivo (Niwa et al., 2002 [PubMed 11832213]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003984-M01A
Species: Hu, Mu, Rt
Applications: WB, ELISA, IF
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
H00001072-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-49245
Species: Hu
Applications: IHC
NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00054961-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-71870
Species: Hu
Applications: WB, IP, PLA
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-31267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
H00054434-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for SSH1 Partial Recombinant Protein (H00054434-Q02) (0)

There are no publications for SSH1 Partial Recombinant Protein (H00054434-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSH1 Partial Recombinant Protein (H00054434-Q02) (0)

There are no reviews for SSH1 Partial Recombinant Protein (H00054434-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSH1 Partial Recombinant Protein (H00054434-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SSH1 Products

Bioinformatics Tool for SSH1 Partial Recombinant Protein (H00054434-Q02)

Discover related pathways, diseases and genes to SSH1 Partial Recombinant Protein (H00054434-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSH1 Partial Recombinant Protein (H00054434-Q02)

Discover more about diseases related to SSH1 Partial Recombinant Protein (H00054434-Q02).
 

Pathways for SSH1 Partial Recombinant Protein (H00054434-Q02)

View related products by pathway.

PTMs for SSH1 Partial Recombinant Protein (H00054434-Q02)

Learn more about PTMs related to SSH1 Partial Recombinant Protein (H00054434-Q02).

Blogs on SSH1

There are no specific blogs for SSH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NOX1 Antibody
NBP1-31546
14-3-3 Antibody
NBP2-27202

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SSH1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SSH1