Recombinant Human SRY Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SRY Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-204 of Human SRY full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SRY
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
50.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00006736-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SRY Protein

  • essential protein for sex determination in human males
  • sex determining region Y
  • sex-determining region on Y
  • sex-determining region Y protein
  • TDFsex determining region protein
  • TDY
  • Testis-determining factor

Background

This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3075
Species: Hu
Applications: WB, ICC
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-57923
Species: Hu
Applications: ICC/IF
PP-H7431-00
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
H00007258-Q01
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF475
Species: Mu
Applications: WB, IHC
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
22240002
Species: Hu
Applications: WB, ELISA
NBP2-58327
Species: Hu
Applications: WB, ICC/IF
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2569
Species: Hu
Applications: WB, ICC
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
H00006736-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SRY Recombinant Protein (H00006736-P01)(1)

Reviews for SRY Recombinant Protein (H00006736-P01) (0)

There are no reviews for SRY Recombinant Protein (H00006736-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRY Recombinant Protein (H00006736-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SRY Recombinant Protein (H00006736-P01)

Discover related pathways, diseases and genes to SRY Recombinant Protein (H00006736-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRY Recombinant Protein (H00006736-P01)

Discover more about diseases related to SRY Recombinant Protein (H00006736-P01).
 

Pathways for SRY Recombinant Protein (H00006736-P01)

View related products by pathway.

PTMs for SRY Recombinant Protein (H00006736-P01)

Learn more about PTMs related to SRY Recombinant Protein (H00006736-P01).

Blogs on SRY

There are no specific blogs for SRY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SRY Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SRY