SRP68 Antibody (3A3) - Azide and BSA Free

Western Blot: SRP68 Antibody (3A3) [H00006730-M03] - Analysis of SRP68 expression in HeLa (Cat # L013V1).

Immunocytochemistry/Immunofluorescence: SRP68 Antibody (3A3) [H00006730-M03] - Analysis of monoclonal antibody to SRP68 on HeLa cell. Antibody concentration 10 ug/ml

ELISA: SRP68 Antibody (3A3) [H00006730-M03] - Detection limit for recombinant GST tagged SRP68 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3A3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SRP68 Antibody (3A3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SRP68 (NP_055045.2, 531 a.a. ~ 627 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRS
• Specificity: SRP68 - signal recognition particle 68kDa (3A3)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SRP68
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity Against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SRP68 Antibody (3A3) - Azide and BSA Free

• signal recognition particle 68 kDa protein
• signal recognition particle 68kD
• signal recognition particle 68kDa

Background

The signal recognition particle (SRP) is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. This gene encodes the 68kDa component of the SRP. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SRP68
• Entrez:
  • 6730(Human)
• Uniprot:
  • NP_055045(Human)