Recombinant Human SRGAP1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SRGAP1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 952-1050 of Human SRGAP1

Source: Wheat Germ

Amino Acid Sequence: PLDPETIAQDIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSSEPQIRRSTSSSSDTMSTFKPMVAPRMGVQL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SRGAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SRGAP1 Protein

  • ARHGAP13srGAP1
  • FLJ22166
  • KIAA1304SLIT-ROBO Rho GTPase-activating protein 1
  • Rho GTPase-activating protein 13
  • SLIT-ROBO Rho GTPase activating protein 1

Background

SRGAP1 - SLIT-ROBO Rho GTPase activating protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-66250
Species: Hu
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-89732
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93587
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90852
Species: Hu
Applications: IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-81479
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57680
Species: Hu
Applications: ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC

Publications for SRGAP1 Partial Recombinant Protein (H00057522-Q01) (0)

There are no publications for SRGAP1 Partial Recombinant Protein (H00057522-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRGAP1 Partial Recombinant Protein (H00057522-Q01) (0)

There are no reviews for SRGAP1 Partial Recombinant Protein (H00057522-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRGAP1 Partial Recombinant Protein (H00057522-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SRGAP1 Products

Bioinformatics Tool for SRGAP1 Partial Recombinant Protein (H00057522-Q01)

Discover related pathways, diseases and genes to SRGAP1 Partial Recombinant Protein (H00057522-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRGAP1 Partial Recombinant Protein (H00057522-Q01)

Discover more about diseases related to SRGAP1 Partial Recombinant Protein (H00057522-Q01).
 

Pathways for SRGAP1 Partial Recombinant Protein (H00057522-Q01)

View related products by pathway.

PTMs for SRGAP1 Partial Recombinant Protein (H00057522-Q01)

Learn more about PTMs related to SRGAP1 Partial Recombinant Protein (H00057522-Q01).
 

Research Areas for SRGAP1 Partial Recombinant Protein (H00057522-Q01)

Find related products by research area.

Blogs on SRGAP1

There are no specific blogs for SRGAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SRGAP1 Antibody (5D2)
H00057522-M03
ARHGAP1 Antibody
NBP1-85724

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SRGAP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SRGAP1