SPRYD7 Antibody (2G4) - Azide and BSA Free

Western Blot: SPRYD7 Antibody (2G4) [H00057213-M01] - C13orf1 monoclonal antibody (M01), clone 2G4 Analysis of C13orf1 expression in PC-12.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 2G4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SPRYD7 Antibody (2G4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SPRYD7 Antibody (2G4) - Azide and BSA Free (H00057213-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: C13orf1 (NP_065189, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF
• Specificity: C13orf1 - chromosome 13 open reading frame 1
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SPRYD7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPRYD7 Antibody (2G4) - Azide and BSA Free

• chromosome 13 open reading frame 1
• chronic lymphocytic leukemia deletion region gene 6 protein
• CLLD6CLL deletion region gene 6 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPRYD7
• Entrez:
  • 57213(Human)
• OMIM:
  • 607866(Human)
• Uniprot:
  • NP_065189(Human)