SPRR4 Antibody (1G5)

Western Blot: SPRR4 Antibody (1G5) [H00163778-M04] - Analysis of SPRR4 expression in transfected 293T cell line by SPRR4 monoclonal antibody (M04), clone 1G5. Lane 1: SPRR4 transfected lysate (Predicted MW: 8.8 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: SPRR4 Antibody (1G5) [H00163778-M04] - Detection limit for recombinant GST tagged SPRR4 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, S-ELISA
• Clone: 1G5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

SPRR4 Antibody (1G5) Summary

• Immunogen: SPRR4 (NP_775103.1, 1 a.a. ~ 79 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTIIPAQQKCPSAQQASKSKQK
• Specificity: This product is specific for Human SPRR4 monoclonal antibody (M04), clone 1G5 [Gene ID: 163778].
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SPRR4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a full-length recombinant SPRR4.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPRR4 Antibody (1G5)

• MGC138375
• MGC138377
• small proline rich protein 4
• small proline-rich protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPRR4
• Uniprot:
  • NP_775103.1(Human)