Home » SPRR2G » SPRR2G Proteins » Recombinant Human SPRR2G Protein

Recombinant Human SPRR2G Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human SPRR2G Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 26665 of Human SPRR2G full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPPCQQKYPPKSK
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SPRR2G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
34.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPRR2G Protein

  • small proline-rich protein 2G
  • SPR-2G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SCGF/CLEC11a
Antibody (239029) [Un ...
MAB1904
SCGF/CLEC11a was detected in immersion fixed IFN gamma activated THP-1 human acute monocytic leukemia cell line using 10 µg/mL Mouse Anti-Human SCGF/CLEC11a Monoclonal Antibody (Catalog # MAB1904) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
SCGF/CLEC11a was detected in immersion fixed paraffin-embedded sections of human spleen using 25 µg/mL Mouse Anti-Human SCGF/CLEC11a Monoclonal Antibody (Catalog # MAB1904) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: WB, IHC, ICC
beta
2-Microglobulin Antib
NB500-317
Western Blot: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Analysis using the FITC conjugate of NB500-317. Detection (non-reducing conditions) of whole cell lysate of various cell lines Lane 1: RAJI human Burkitt lymphoma cell line Lane 2: EL4 mouse lymphoblastic lymphoma cell line Lane 3: U937 human histiocytic lymphoma cell line.
Immunocytochemistry/Immunofluorescence: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Confocal microscopy of human beta2-microglobulin-transfected canine cells labeled A) with B2M-01 antibody Alexa Fluor (R) 647 conjugate and B) with Alexa Fluor (R) 647 conjugated Mouse IgG2a Isotype Control. Cells were fixed with 4% PFA and permeabilized with 0.1% PBS-Tween20 containing 2% BSA. Antibody concentration 2ug/ml.
Flow Cytometry: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Surface staining of beta2-microglobulin in human peripheral blood with anti-beta2-microglobulin (B2M-01) PE.
(2 Publications)
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
GBP5 Antibody
(OTI5C9)
NBP2-03468
Western Blot: GBP5 Antibody (5C9) [NBP2-03468] Analysis of extracts (35ug) from 9 different cell lines by using anti-GBP5 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: GBP5 Antibody (5C9) [NBP2-03468] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY GBP5.
Flow Cytometry: GBP5 Antibody (5C9) [NBP2-03468] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GBP5 antibody, and then analyzed by flow cytometry.
Species: Hu, Pm
Applications: WB, Flow, ICC/IF
ING1 Antibody
AF5758
Western blot shows lysates of A549 human lung carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for ING1 at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
ING1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using 10 µg/mL Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
ING1 was detected in immersion fixed paraffin-embedded sections of human lung cancer tissue using 5 µg/mL Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, IHC, ICC
Galectin-1
Antibody [Unconjugate
AF1152
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and A549 human lung carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Galectin‑1 at approximately 14 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Human peripheral blood monocytes were stained with Mouse Anti-Human CD14 PE-conjugated Monoclonal Antibody (Catalog # FAB3832P) and either (A) Normal Goat IgG Control (Catalog # AB-108-C) or (B) Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Galectin‑1 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using 1.7 µg/mL Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Reviews)
(9 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Uroplakin III
Antibody
NBP1-86873
Immunohistochemistry-Paraffin: Uroplakin III Antibody [NBP1-86873] - Staining of human urinary bladder shows high expression.
Immunohistochemistry-Paraffin: Uroplakin III Antibody [NBP1-86873] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: Uroplakin III Antibody [NBP1-86873] - Staining in human urinary bladder and kidney tissues using anti-UPK3A antibody. Corresponding UPK3A RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
SPRR4 Antibody
NBP2-30889
Immunohistochemistry-Paraffin: SPRR4 Antibody [NBP2-30889] - Staining of human skin shows high expression.
Immunohistochemistry: SPRR4 Antibody [NBP2-30889] - Staining of human vulva/anal skin shows strong cytoplasmic and nuclear positivity in epidermal cells.
Immunohistochemistry-Paraffin: SPRR4 Antibody [NBP2-30889] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
HLA G Antibody
(87G)
NBP1-43123
Western Blot: HLA G Antibody (87G) [NBP1-43123] - Total protein from human and mouse placental tissue, mouse platelets and Ramos cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-HLA G (87G) in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: HLA G Antibody (87G) [NBP1-43123] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti HLA G (87G) at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: HLA G Antibody (87G) [NBP1-43123] - Intracellular flow cytometric staining of 1 x 10^6 HEK-293 cells using HLA G antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(7 Publications)
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, CyTOF-ready
Uroplakin II
Antibody
NBP2-38904
Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-38904] - Staining of human urinary bladder shows high expression.
Flow Cytometry: Uroplakin II Antibody [NBP2-38904] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-38904] - Staining of human endometrium shows low expression as expected.
(2 Reviews)
Species: Hu
Applications: Flow, IHC, IHC-P
MHC Class I
Antibody (OX18)
NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MHC Class I Antibody (OX18) [NB120-6405] - IHC analysis of formalin fixed paraffin-embedded (FFPE) rat brain cerebellum using MHC Class I (OK18) antibody at 1:200 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Endothelial staining was observed. Staining was performed by Histowiz.
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
(29 Publications)
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Recombinant Human
SPRR2F Protein
H00006705-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
AKAP13 Antibody
(3D6)
H00011214-M10
Western Blot: AKAP13 Antibody (3D6) [H00011214-M10] - Analysis of AKAP13 expression in HeLa.
Immunohistochemistry-Paraffin: AKAP13 Antibody (3D6) [H00011214-M10] - Analysis of monoclonal antibody to AKAP13 on formalin-fixed paraffin-embedded human spleen. Antibody concentration 1.5 ug/ml
Western Blot: AKAP13 Antibody (3D6) [H00011214-M10] - Western Blot analysis of AKAP13 expression in PC-12(Cat # L012V1 ).
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Glutathione
S-transferase Mu 5 An
NBP1-32682
Western Blot: Glutathione S-transferase Mu 5 Antibody [NBP1-32682] - Sample (50 ug of whole cell lysate) A: rat testis 12% SDS PAGE; antibody diluted at 1:10000.
Immunocytochemistry/Immunofluorescence: Glutathione S-transferase Mu 5 Antibody [NBP1-32682] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Glutathione S-transferase Mu 5 Antibody [NBP1-32682] - Paraffin-embedded SG xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
SPRR2G Protein
H00006706-P01
Recombinant Human SPRR2G Protein
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SPRR2G Recombinant Protein (H00006706-P01) (0)

There are no publications for SPRR2G Recombinant Protein (H00006706-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPRR2G Recombinant Protein (H00006706-P01) (0)

There are no reviews for SPRR2G Recombinant Protein (H00006706-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPRR2G Recombinant Protein (H00006706-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPRR2G Products

SPRR2G H00006706-P01

Bioinformatics Tool for SPRR2G Recombinant Protein (H00006706-P01)

Discover related pathways, diseases and genes to SPRR2G Recombinant Protein (H00006706-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPRR2G Recombinant Protein (H00006706-P01)

Discover more about diseases related to SPRR2G Recombinant Protein (H00006706-P01).
 

Pathways for SPRR2G Recombinant Protein (H00006706-P01)

View related products by pathway.

Blogs on SPRR2G

There are no specific blogs for SPRR2G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
MHC Class I Antibody (OX18)
NB120-6405
Western Blot: SPRR2G Overexpression Lysate (Adult Normal) [NBP2-08735] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for SPRR2G.
SPRR2G Overexpression Lysate (Native)
NBP2-08735
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and A549 human lung carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Galectin‑1 at approximately 14 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Galectin-1 Antibody [Unconjugated]
AF1152
Western Blot: HLA G Antibody (87G) [NBP1-43123] - Total protein from human and mouse placental tissue, mouse platelets and Ramos cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-HLA G (87G) in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
HLA G Antibody (87G)
NBP1-43123-0.1mg

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPRR2G Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SPRR2G