Recombinant Human SPO11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPO11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 291-395 of Human SPO11 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SPO11
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPO11 Protein

  • Cancer/testis antigen 35
  • CT35MGC39953
  • meiotic recombination protein SPO11
  • SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)
  • SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae)
  • SPO11, meiotic protein covalently bound to DSB (S. cerevisiae)-like

Background

Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-181
Species: Hu, Mu
Applications: WB, IP
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
29470002
Species: Ce
Applications: ELISA, ICC/IF, IHC
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP2-57274
Species: Hu
Applications: WB, ICC/IF
NB100-56552
Species: Hu
Applications: WB
NBP1-58170
Species: Hu
Applications: WB
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP2-58116
Species: Hu
Applications: ICC/IF
NBP1-90240
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-80844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00023626-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SPO11 Partial Recombinant Protein (H00023626-Q01) (0)

There are no publications for SPO11 Partial Recombinant Protein (H00023626-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPO11 Partial Recombinant Protein (H00023626-Q01) (0)

There are no reviews for SPO11 Partial Recombinant Protein (H00023626-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPO11 Partial Recombinant Protein (H00023626-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPO11 Products

Bioinformatics Tool for SPO11 Partial Recombinant Protein (H00023626-Q01)

Discover related pathways, diseases and genes to SPO11 Partial Recombinant Protein (H00023626-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPO11 Partial Recombinant Protein (H00023626-Q01)

Discover more about diseases related to SPO11 Partial Recombinant Protein (H00023626-Q01).
 

Pathways for SPO11 Partial Recombinant Protein (H00023626-Q01)

View related products by pathway.

PTMs for SPO11 Partial Recombinant Protein (H00023626-Q01)

Learn more about PTMs related to SPO11 Partial Recombinant Protein (H00023626-Q01).
 

Research Areas for SPO11 Partial Recombinant Protein (H00023626-Q01)

Find related products by research area.

Blogs on SPO11

There are no specific blogs for SPO11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nbs1 Antibody
NB100-143
SPO11 Antibody
NBP1-58172
Mre11 Antibody
NB100-142

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPO11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPO11