Recombinant Human SPO11 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human SPO11 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 291-395 of Human SPO11

Source: Wheat Germ (in vitro)

Amino Acid Sequence: YGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGW

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SPO11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPO11 GST (N-Term) Protein

  • Cancer/testis antigen 35
  • CT35MGC39953
  • meiotic recombination protein SPO11
  • SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)
  • SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae)
  • SPO11, meiotic protein covalently bound to DSB (S. cerevisiae)-like

Background

Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-181
Species: Hu, Mu
Applications: IP, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-87145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-20946
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
H00004438-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-56155
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
NBP2-03688
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-58116
Species: Hu
Applications: ICC/IF, KD, WB
H00000104-P01
Species: Hu
Applications: ELISA, AP, IHC, KA, PA, WB
NBP1-80844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

Publications for SPO11 Partial Recombinant Protein (H00023626-Q01) (0)

There are no publications for SPO11 Partial Recombinant Protein (H00023626-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPO11 Partial Recombinant Protein (H00023626-Q01) (0)

There are no reviews for SPO11 Partial Recombinant Protein (H00023626-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPO11 Partial Recombinant Protein (H00023626-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPO11 Products

Bioinformatics Tool for SPO11 Partial Recombinant Protein (H00023626-Q01)

Discover related pathways, diseases and genes to SPO11 Partial Recombinant Protein (H00023626-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPO11 Partial Recombinant Protein (H00023626-Q01)

Discover more about diseases related to SPO11 Partial Recombinant Protein (H00023626-Q01).
 

Pathways for SPO11 Partial Recombinant Protein (H00023626-Q01)

View related products by pathway.

PTMs for SPO11 Partial Recombinant Protein (H00023626-Q01)

Learn more about PTMs related to SPO11 Partial Recombinant Protein (H00023626-Q01).
 

Research Areas for SPO11 Partial Recombinant Protein (H00023626-Q01)

Find related products by research area.

Blogs on SPO11

There are no specific blogs for SPO11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nbs1 Antibody
NB100-143
ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPO11 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPO11