SPNS2 Antibody - BSA Free

Western Blot: SPNS2 Antibody [NBP1-54345] - 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Muscle

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SPNS2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SPNS2(spinster homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of SPNS2 (NP_001118230). Peptide sequence PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPNS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SPNS2 Antibody - BSA Free

• protein spinster homolog 2
• spinster homolog 2 (Drosophila)

Background

SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPNS2 Antibody (NBP1-54345)(4)

Publications using NBP1-54345

• Liang W, Liu M, Su Y et al. Spinster homolog 2 reduces malignancies of glioblastoma via PTEN/PI3K/AKT pathway IUBMB life 2023-09-20 [PMID: 37728571] (IHC-P)
• Lv L, Yi Q, Yan Y et al. SPNS2 Downregulation Induces EMT and Promotes Colorectal Cancer Metastasis via Activating AKT Signaling Pathway Frontiers in Oncology 2021-06-24 [PMID: 34249729] (Immunohistochemistry-Paraffin, Human)
• Ha AW, Bai T, Ebenezer DL et al. Sphingosine kinase 1 regulates lysyl oxidase through STAT3 in hyperoxia-mediated neonatal lung injury Thorax 2021-04-21 [PMID: 33883249]
• Lu J, Tseng Y, Lo Y et al. Prognostic Significance of Cytoplasmic SPNS2 Expression in Patients with Oral Squamous Cell Carcinoma Medicina 2021-02-12 [PMID: 33673355] (IHC-P, Human)

Bioinformatics

• Gene Symbol: SPNS2
• Entrez:
  • 124976(Human)
  • 216892(Mouse)
  • 100270678(Rat)
• Uniprot:
  • Q8IVW8(Human)