SPNS2 Antibody

Images

 
Western Blot: SPNS2 Antibody [NBP1-54345] - 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Muscle
Immunohistochemistry-Paraffin: SPNS2 Antibody [NBP1-54345] - Human Heart Tissue, antibody concentration 5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPNS2 Antibody Summary

Immunogen
Synthetic peptides corresponding to SPNS2(spinster homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of SPNS2 (NP_001118230). Peptide sequence PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPNS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPNS2 Antibody

  • protein spinster homolog 2
  • spinster homolog 2 (Drosophila)

Background

SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP2-52567
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP1-54345
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SPNS2 Antibody (NBP1-54345) (0)

There are no publications for SPNS2 Antibody (NBP1-54345).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPNS2 Antibody (NBP1-54345) (0)

There are no reviews for SPNS2 Antibody (NBP1-54345). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPNS2 Antibody (NBP1-54345) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPNS2 Products

SPNS2 NBP1-54345

Bioinformatics Tool for SPNS2 Antibody (NBP1-54345)

Discover related pathways, diseases and genes to SPNS2 Antibody (NBP1-54345). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPNS2 Antibody (NBP1-54345)

Discover more about diseases related to SPNS2 Antibody (NBP1-54345).
 

Pathways for SPNS2 Antibody (NBP1-54345)

View related products by pathway.

PTMs for SPNS2 Antibody (NBP1-54345)

Learn more about PTMs related to SPNS2 Antibody (NBP1-54345).

Blogs on SPNS2

There are no specific blogs for SPNS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPNS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPNS2
Entrez
Uniprot