SPIRE1 Antibody (4C5)

Images

 
Western Blot: SPIRE1 Antibody (4C5) [H00056907-M01] - Analysis of SPIRE1 expression in transfected 293T cell line by SPIRE1 monoclonal antibody (M01), clone 4C5.Lane 1: SPIRE1 transfected lysate(15 KDa).Lane 2: ...read more
Sandwich ELISA: SPIRE1 Antibody (4C5) [H00056907-M01] - Detection limit for recombinant GST tagged SPIRE1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, HaSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SPIRE1 Antibody (4C5) Summary

Immunogen
SPIRE1 (NP_064533, 482 a.a. ~ 583 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI
Specificity
SPIRE1 - spire homolog 1 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPIRE1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using H00056907-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPIRE1 Antibody (4C5)

  • KIAA1135
  • MGC150621
  • MGC150622
  • protein spire homolog 1
  • SPIR1
  • Spir-1
  • spire homolog 1 (Drosophila)

Background

Spire proteins, such as SPIRE1, are highly conserved between species. They belong to the family of Wiskott-Aldrich homology region-2 (WH2) proteins, which are involved in actin organization (Kerkhoff et al., 2001 [PubMed 11747823]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47261
Species: Hu
Applications: ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24615
Species: Hu
Applications: WB, IHC, IHC-P
MAB4368
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-45863
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31310
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP1-86859
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-92822
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15396
Species: Hu
Applications: WB, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-80773
Species: Hu
Applications: IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-45499
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-83086
Species: Hu
Applications: WB
NBP1-81260
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49643
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, Flow-IC, KO
NBP1-82956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2069
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00056907-M01
Species: Hu, Ha
Applications: WB, ELISA, S-ELISA

Publications for SPIRE1 Antibody (H00056907-M01)(3)

Reviews for SPIRE1 Antibody (H00056907-M01) (0)

There are no reviews for SPIRE1 Antibody (H00056907-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPIRE1 Antibody (H00056907-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPIRE1 Products

Bioinformatics Tool for SPIRE1 Antibody (H00056907-M01)

Discover related pathways, diseases and genes to SPIRE1 Antibody (H00056907-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPIRE1 Antibody (H00056907-M01)

Discover more about diseases related to SPIRE1 Antibody (H00056907-M01).
 

Pathways for SPIRE1 Antibody (H00056907-M01)

View related products by pathway.

Blogs on SPIRE1

There are no specific blogs for SPIRE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPIRE1 Antibody (4C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPIRE1
Entrez
OMIM
Uniprot