SPANXC Antibody

Images

 
Western Blot: SPANXC Antibody [NBP2-86825] - WB Suggested Anti-SPANXC Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPANXC Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of SPANXC. Peptide sequence: EVNETMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELLN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SPANXC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPANXC Antibody

  • B1
  • C
  • cancer/testis antigen 11.3
  • cancer/testis antigen family 11, member 3
  • cancer/testis-associated protein CTp11
  • cancer/testis-associated protein of 11 kD
  • cancer-testis-associated protein CTp11
  • CT11.1
  • CT11.2
  • CT11.3
  • CT11.4
  • CTp11
  • dJ171K16.1
  • NAP-X
  • nuclear-associated protein SPAN-Xc
  • SPANX family, member C
  • SPANX
  • SPANXA
  • SPAN-Xa
  • SPANX-A
  • SPANXB
  • SPAN-Xb
  • SPANX-B
  • SPAN-Xc protein
  • SPANX-C
  • SPANX-D
  • sperm protein associated with the nucleus on the X chromosome C
  • sperm protein associated with the nucleus, X chromosome, family member C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00030014-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP2-34754
Species: Ca, Hu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30151
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-68961
Species: Hu
Applications: IHC, IHC-P
NBP1-84345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP1-80323
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00006757-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP1-89173
Species: Hu
Applications: IHC, IHC-P

Publications for SPANXC Antibody (NBP2-86825) (0)

There are no publications for SPANXC Antibody (NBP2-86825).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPANXC Antibody (NBP2-86825) (0)

There are no reviews for SPANXC Antibody (NBP2-86825). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPANXC Antibody (NBP2-86825) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPANXC Products

Array NBP2-86825

Bioinformatics Tool for SPANXC Antibody (NBP2-86825)

Discover related pathways, diseases and genes to SPANXC Antibody (NBP2-86825). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPANXC Antibody (NBP2-86825)

Discover more about diseases related to SPANXC Antibody (NBP2-86825).
 

Pathways for SPANXC Antibody (NBP2-86825)

View related products by pathway.

Research Areas for SPANXC Antibody (NBP2-86825)

Find related products by research area.

Blogs on SPANXC

There are no specific blogs for SPANXC, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPANXC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPANXC