SPAM1 Synthetic Peptide

Images

 
There are currently no images for SPAM1 Protein (NBP2-83580PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, AC
Concentration
LYOPH

Order Details

SPAM1 Synthetic Peptide Summary

Description
55kDa synthetic peptide located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP (Uniprot: P38567)

The peptide is characterized by mass spectroscopy
Source
Synthetic
Protein/Peptide Type
Synthetic Peptide
Gene
SPAM1
Purity
Multi-step

Applications/Dilutions

Dilutions
  • Antibody Competition
  • Western Blot
Application Notes
This peptide is useful as a blocking peptide for NBP2-83580. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochemistry under proper experimental settings.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Concentration
LYOPH
Purity
Multi-step
Reconstitution Instructions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS

Alternate Names for SPAM1 Synthetic Peptide

  • EC 3.2.1.35
  • HYA1
  • HYAL1
  • HYAL3
  • HYAL5
  • hyal-PH20
  • hyaluronidase PH-20
  • Hyaluronoglucosaminidase PH-20
  • MGC26532
  • PH20
  • PH-20
  • SPAG15
  • SPAM1
  • sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
  • Sperm adhesion molecule 1
  • Sperm surface protein PH-20

Background

Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81283
Species: Hu
Applications: IHC,  IHC-P
NBP1-51635
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-37446
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP2-37494
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
6904-GH
Species: Hu
Applications: EnzAct
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-14260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP2-47579
Species: Hu
Applications: IB, ICC/IF, IHC,  IHC-P, WB
NBP2-52533
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB

Publications for SPAM1 Protein (NBP2-83580PEP) (0)

There are no publications for SPAM1 Protein (NBP2-83580PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPAM1 Protein (NBP2-83580PEP) (0)

There are no reviews for SPAM1 Protein (NBP2-83580PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPAM1 Protein (NBP2-83580PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPAM1 Products

Research Areas for SPAM1 Protein (NBP2-83580PEP)

Find related products by research area.

Blogs on SPAM1.

Funny Protein Names Infographic
This is not a joke, these proteins with funny names actually do exist. View our list of six proteins with funny and unusual names including: Bambi, Yippee-like 3, Wee1, SPAM1, SPOCK1 and Bagpipe homeobox protein homolog 1. Learn more about their fu...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SPAM1 Synthetic Peptide and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAM1