Recombinant Human SP140 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SP140 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 504-612 of Human SP140

Source: Wheat Germ

Amino Acid Sequence: GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SP140
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SP140 Protein

  • Lymphoid-restricted homolog of Sp100
  • lymphoid-specific SP100 homolog
  • LYSP100
  • LYSP100-A
  • LYSP100-B
  • MGC126440
  • Nuclear autoantigen Sp-140
  • nuclear body protein SP140
  • SP140 nuclear body protein
  • Speckled 140 kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
AF1141
Species: Mu
Applications: WB, IHC, IP
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-13809
Species: Hu
Applications: WB, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
AF5525
Species: Hu
Applications: WB, IHC
AF755
Species: Mu
Applications: WB, Block
MAB1287
Species: Mu
Applications: WB
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00001820-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB120-2940
Species: Hu, Mu, Pm
Applications: WB, ICC/IF
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
NBP2-33434
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SP140 Partial Recombinant Protein (H00011262-Q01) (0)

There are no publications for SP140 Partial Recombinant Protein (H00011262-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP140 Partial Recombinant Protein (H00011262-Q01) (0)

There are no reviews for SP140 Partial Recombinant Protein (H00011262-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SP140 Partial Recombinant Protein (H00011262-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SP140 Partial Recombinant Protein (H00011262-Q01)

Discover related pathways, diseases and genes to SP140 Partial Recombinant Protein (H00011262-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP140 Partial Recombinant Protein (H00011262-Q01)

Discover more about diseases related to SP140 Partial Recombinant Protein (H00011262-Q01).
 

Pathways for SP140 Partial Recombinant Protein (H00011262-Q01)

View related products by pathway.

PTMs for SP140 Partial Recombinant Protein (H00011262-Q01)

Learn more about PTMs related to SP140 Partial Recombinant Protein (H00011262-Q01).

Blogs on SP140

There are no specific blogs for SP140, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SP140 Antibody
NBP1-81275

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SP140 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SP140