Recombinant Human Sodium Potassium ATPase Alpha 3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Sodium Potassium ATPase Alpha 3 Protein [H00000478-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Order Details


    • Catalog Number
      H00000478-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Sodium Potassium ATPase Alpha 3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 879-984 of Human Sodium Potassium ATPase Alpha 3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP1A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sodium Potassium ATPase Alpha 3 GST (N-Term) Protein

  • alpha 3 polypeptide
  • ATP1A3
  • ATPase, Na+/K+ transporting, alpha 3 polypeptide
  • dystonia 12
  • DYT12
  • EC 3.6.3
  • MGC13276
  • RDP
  • Sodium Potassium ATPase Alpha 3
  • Sodium pump subunit alpha-3
  • sodium/potassium-transporting ATPase alpha-3 chain
  • sodium/potassium-transporting ATPase subunit alpha-3

Background

The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 3 subunit. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-03780
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
NBP3-45254
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00008575-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
NB300-146
Species: Bv, Ca, Dr, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh, Xp, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-94614
Species: Mu, Rt
Applications: WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-59794
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-32061
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-77847
Species: Hu, Mu
Applications: ChIP, ELISA, IHC,  IHC-P, IP, WB
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-55165
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for Sodium Potassium ATPase Alpha 3 Partial Recombinant Protein (H00000478-Q01) (0)

There are no publications for Sodium Potassium ATPase Alpha 3 Partial Recombinant Protein (H00000478-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sodium Potassium ATPase Alpha 3 Partial Recombinant Protein (H00000478-Q01) (0)

There are no reviews for Sodium Potassium ATPase Alpha 3 Partial Recombinant Protein (H00000478-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sodium Potassium ATPase Alpha 3 Partial Recombinant Protein (H00000478-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sodium Potassium ATPase Alpha 3 Products

Blogs on Sodium Potassium ATPase Alpha 3

There are no specific blogs for Sodium Potassium ATPase Alpha 3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sodium Potassium ATPase Alpha 3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP1A3