SOAT1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SOAT1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOAT1.
  
  

  Source: E. coli

  Amino Acid Sequence: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SOAT1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32052.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SOAT1 Recombinant Protein Antigen

• ACACT
• ACACT1
• ACAT-1
• ACATACAT1
• acyl-Coenzyme A: cholesterol acyltransferase
• Acyl-coenzyme A:cholesterol acyltransferase 1
• Cholesterol acyltransferase 1
• EC 2.3.1.26
• RP11-215I23.2
• SOAT1
• STATSOAT
• sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1
• sterol O-acyltransferase 1

Background

Acely-CoA:cholestorl acyltransferase (ACAT) is an integral membrane enzyme that belongs to type-B carboxylesterase/lipase family. ACAT catalyzes the formation of cholesteryl esters from cholesterol and long-chain fatty-acyl-coenzyme A (1). ACAT also function as a regulator of intracellular cholesterol homeostasis at single cell level. Two isoform of ACAT exists, ACAT1 and ACAT2, are expressed in liver and intestine. However, ACAT1 is only found in macrophages and SMCs (2). The accumulation of cholesteryl esters produced by ACAT in macrophages can lead to foam cell formation, an indication of early stage atherosclerosis. ACAT activity has been linked to Alzehimer's Diease, condition caused by excess amount of amyloid beta-peptide (Abeta). Atherogenic lipoproteins activate ACAT activity, where active ACAT can modulate the level of Abeta (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SOAT1