We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SOAT1 Recombinant Protein Antigen

Images

 
There are currently no images for SOAT1 Recombinant Protein Antigen (NBP2-32052PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SOAT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOAT1.

Source: E. coli

Amino Acid Sequence: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SOAT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32052.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SOAT1 Recombinant Protein Antigen

  • ACACT
  • ACACT1
  • ACAT-1
  • ACATACAT1
  • acyl-Coenzyme A: cholesterol acyltransferase
  • Acyl-coenzyme A:cholesterol acyltransferase 1
  • Cholesterol acyltransferase 1
  • EC 2.3.1.26
  • RP11-215I23.2
  • SOAT1
  • STATSOAT
  • sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1
  • sterol O-acyltransferase 1

Background

Acely-CoA:cholestorl acyltransferase (ACAT) is an integral membrane enzyme that belongs to type-B carboxylesterase/lipase family. ACAT catalyzes the formation of cholesteryl esters from cholesterol and long-chain fatty-acyl-coenzyme A (1). ACAT also function as a regulator of intracellular cholesterol homeostasis at single cell level. Two isoform of ACAT exists, ACAT1 and ACAT2, are expressed in liver and intestine. However, ACAT1 is only found in macrophages and SMCs (2). The accumulation of cholesteryl esters produced by ACAT in macrophages can lead to foam cell formation, an indication of early stage atherosclerosis. ACAT activity has been linked to Alzehimer's Diease, condition caused by excess amount of amyloid beta-peptide (Abeta). Atherogenic lipoproteins activate ACAT activity, where active ACAT can modulate the level of Abeta (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
NBP2-75547
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-25241
Species: Hu, Mu
Applications: ICC/IF, IP, WB
485-MI
Species: Mu
Applications: BA
NBP2-00817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-74271
Species: Hu
Applications: IHC,  IHC-P
6507-IL/CF
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
PAF-ST2
Species: Hu
Applications: IP, KO, WB
AF3194
Species: Hu
Applications: ICC, Simple Western, WB
NB100-781
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
202-IL
Species: Hu
Applications: BA
DGP00
Species: Hu
Applications: ELISA

Publications for SOAT1 Recombinant Protein Antigen (NBP2-32052PEP) (0)

There are no publications for SOAT1 Recombinant Protein Antigen (NBP2-32052PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOAT1 Recombinant Protein Antigen (NBP2-32052PEP) (0)

There are no reviews for SOAT1 Recombinant Protein Antigen (NBP2-32052PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SOAT1 Recombinant Protein Antigen (NBP2-32052PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOAT1 Products

Research Areas for SOAT1 Recombinant Protein Antigen (NBP2-32052PEP)

Find related products by research area.

Blogs on SOAT1.

Using a STAT3 antibody in chromatin immunoprecipitation (ChIP)
Signal transducer and activator of transcription 3 (STAT3) is an important oncogenic transcriptional factor that mediates tumor induced immune suppression.  Specifically, STAT3 transmits signals from cytokines and growth factor receptors in the pla...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SOAT1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SOAT1