SNX30 Antibody

Images

 
Western Blot: SNX30 Antibody [NBP2-83572] - Host: Rabbit. Target Name: Snx30. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX30 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse SNX30. Peptide sequence: VSACIGNCSTALEELTDDITEEFLPVLREYVLYSDSMKGVLKKRDQVQAE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SNX30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX30 Antibody

  • ATG24A
  • FLJ26481
  • FLJ35589
  • sorting nexin family member 30
  • sorting nexin-30

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB935
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
NBP2-47477
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
H00257364-D01P
Species: Hu
Applications: ICC/IF, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00057630-M01
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NBP2-24496
Species: Bv, Ca, Eq, Hu, Mu, Ma-Op, Pm
Applications: WB
NBP2-94059
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75607
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP2-37573
Species: Hu, Pm, Mu, Pm, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
AF3926
Species: Hu, Mu, Rt
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-82361
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-02609
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-83572
Species: Mu
Applications: WB

Publications for SNX30 Antibody (NBP2-83572) (0)

There are no publications for SNX30 Antibody (NBP2-83572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX30 Antibody (NBP2-83572) (0)

There are no reviews for SNX30 Antibody (NBP2-83572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNX30 Antibody (NBP2-83572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNX30 Products

Bioinformatics Tool for SNX30 Antibody (NBP2-83572)

Discover related pathways, diseases and genes to SNX30 Antibody (NBP2-83572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX30 Antibody (NBP2-83572)

Discover more about diseases related to SNX30 Antibody (NBP2-83572).
 

Pathways for SNX30 Antibody (NBP2-83572)

View related products by pathway.

Blogs on SNX30

There are no specific blogs for SNX30, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX30