SNX26 Antibody - BSA Free

Western Blot: SNX26 Antibody [NBP3-09643] - Western blot analysis of SNX26 in 721_B Whole Cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SNX26 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human SNX26 (NP_001166101.1). Peptide sequence PEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPW
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP33
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 92 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SNX26 Antibody - BSA Free

• FLJ39019
• neurite outgrowth multiadaptor RhoGAP protein
• NOMA-GAP
• Rho GTPase activating protein 33
• rho GTPase-activating protein 33
• Rho-type GTPase-activating protein 33
• sorting nexin 26
• Sorting nexin-26
• Tc10/CDC42 GTPase-activating protein
• TCGAPSNX26

Background

SNX26 encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The specific function of this protein has not been elucidated. Alternative splice variants have been described but their full length nature has not been determined. SNX26 may be involved in several stages of intracellular trafficking. It could play an important role in the regulation of glucose transport by insulin. It may act as a downstream effector of RHOQ/TC10 in the regulation of insulin-stimulated glucose transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP33