We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SNRPB2 Recombinant Protein Antigen

Images

 
There are currently no images for SNRPB2 Recombinant Protein Antigen (NBP2-58608PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SNRPB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SNRPB2.

Source: E. coli

Amino Acid Sequence: TVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SNRPB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58608.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SNRPB2 Recombinant Protein Antigen

  • MGC24807
  • MGC45309
  • Msl1
  • small nuclear ribonucleoprotein polypeptide B
  • small nuclear ribonucleoprotein polypeptide B''
  • small nuclear ribonucleoprotein polypeptide B2
  • U2 small nuclear ribonucleoprotein B''
  • U2 snRNP B''

Background

The protein encoded by the SNRPB2 gene associates with stem loop IV of U2 small nuclear ribonucleoprotein (U2 snRNP) in the presence of snRNP-A'. The encoded protein may play a role in pre-mRNA splicing. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83853
Species: Hu
Applications: IP, WB
NB100-55251
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-19419
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-46113
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
NBL1-11570
Species: Hu
Applications: WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
NBP2-53095
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF844
Species: Mu
Applications: Block, IHC, WB
NBP2-33447
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP3-37988
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-57100
Species: Hu
Applications: ICC/IF
NB500-174
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB

Publications for SNRPB2 Recombinant Protein Antigen (NBP2-58608PEP) (0)

There are no publications for SNRPB2 Recombinant Protein Antigen (NBP2-58608PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNRPB2 Recombinant Protein Antigen (NBP2-58608PEP) (0)

There are no reviews for SNRPB2 Recombinant Protein Antigen (NBP2-58608PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SNRPB2 Recombinant Protein Antigen (NBP2-58608PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SNRPB2 Products

Research Areas for SNRPB2 Recombinant Protein Antigen (NBP2-58608PEP)

Find related products by research area.

Blogs on SNRPB2

There are no specific blogs for SNRPB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SNRPB2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRPB2