Snapin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Snapin Antibody [NBP1-92414] - Staining of human cell line A-431 shows localization to nucleoli & the Golgi apparatus.

Immunohistochemistry-Paraffin: Snapin Antibody [NBP1-92414] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Snapin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYP
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNAPIN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Snapin Protein (NBP1-92414PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Snapin Antibody - BSA Free

• SNAP-25-binding protein
• SNAP25BP
• SNAPAP
• SNAPAPSNARE-associated protein Snapin
• SNAP-associated proteinSNARE associated protein snapin
• Snapin
• Synaptosomal-associated protein 25-binding protein

Background

SNAPIN is a component of the SNARE complex of proteins that is required for synaptic vesicle docking and fusion. It may modulate a step between vesicle priming, fusion and calcium dependent neurotransmitter release by potentiating the interaction of synaptotagmins with the SNAREs and the plasma membrane associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. It may also have a role in the mechanisms of SNARE mediated membrane fusion in non neuronal cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNAPIN