Recombinant Human SNAPC3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SNAPC3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 311-410 of Human SNAPC3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YCHQGDCEHVIVITDIRLVHHDDCLDRTLYPLLIKKHWLWTRKCFVCKMYTARWVTNNDSFAPEDPCFFCDVCFRMLHYDSEGNKLGEFLAYPYVDPGTF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SNAPC3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SNAPC3 Protein

  • MGC132011
  • MGC33124
  • Proximal sequence element-binding transcription factor subunit beta
  • PSE-binding factor subunit beta
  • PTF subunit beta
  • PTFbeta
  • small nuclear RNA activating complex, polypeptide 3, 50kD
  • small nuclear RNA activating complex, polypeptide 3, 50kDa
  • Small nuclear RNA-activating complex polypeptide 3
  • SNAP50SNAPc 50 kDa subunit
  • SNAPc subunit 3
  • snRNA-activating protein complex 50 kDa subunit
  • snRNA-activating protein complex subunit 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58560
Species: Hu
Applications: ICC/IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00006621-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-55746
Species: Hu
Applications: ICC/IF
NBP2-56499
Species: Hu
Applications: ICC/IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47267
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
H00055814-R01
Species: Hu
NBP2-15617
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55335
Species: Hu
Applications: WB, ICC/IF
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009014-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-12779
Species: Hu
Applications: WB, IP
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58867
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-45910
Species: Hu
Applications: WB, IHC
H00006619-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SNAPC3 Partial Recombinant Protein (H00006619-Q01) (0)

There are no publications for SNAPC3 Partial Recombinant Protein (H00006619-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNAPC3 Partial Recombinant Protein (H00006619-Q01) (0)

There are no reviews for SNAPC3 Partial Recombinant Protein (H00006619-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNAPC3 Partial Recombinant Protein (H00006619-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SNAPC3 Products

Bioinformatics Tool for SNAPC3 Partial Recombinant Protein (H00006619-Q01)

Discover related pathways, diseases and genes to SNAPC3 Partial Recombinant Protein (H00006619-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNAPC3 Partial Recombinant Protein (H00006619-Q01)

Discover more about diseases related to SNAPC3 Partial Recombinant Protein (H00006619-Q01).
 

Pathways for SNAPC3 Partial Recombinant Protein (H00006619-Q01)

View related products by pathway.

Blogs on SNAPC3

There are no specific blogs for SNAPC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SNAPC3 Antibody
NBP2-57713
OCT1 Antibody
NBP2-21584

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SNAPC3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAPC3