SMARCA5/SNF2H Antibody (3F4)

Images

 
Immunocytochemistry/ Immunofluorescence: SMARCA5/SNF2H Antibody (3F4) [H00008467-M02] - Analysis of monoclonal antibody to SMARCA5 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: SMARCA5/SNF2H Antibody (3F4) [H00008467-M02] - Analysis of monoclonal antibody to SMARCA5 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Sandwich ELISA: SMARCA5/SNF2H Antibody (3F4) [H00008467-M02] - Detection limit for recombinant GST tagged SMARCA5 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
3F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SMARCA5/SNF2H Antibody (3F4) Summary

Immunogen
SMARCA5 (NP_003592, 59 a.a. - 147 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE
Specificity
SMARCA5 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 (3F4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMARCA5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMARCA5/SNF2H Antibody (3F4)

  • EC 3.6.1
  • EC 3.6.4.-
  • hISWI
  • hSNF2HSWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5
  • ISWI
  • SMARCA5
  • SNF2H
  • SNF2Hsucrose nonfermenting-like 5
  • subfamily a, member 5
  • Sucrose nonfermenting protein 2 homolog
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 5
  • WCRF135

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB100-61041
Species: Hu
Applications: WB, IP
NB600-279
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57248
Species: Hu
Applications: WB, ICC/IF
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59158
Species: Hu, Mu
Applications: WB, ChIP
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB100-41418
Species: Hu
Applications: WB, IHC-P, IP
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBL1-11569
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF

Publications for SMARCA5/SNF2H Antibody (H00008467-M02) (0)

There are no publications for SMARCA5/SNF2H Antibody (H00008467-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCA5/SNF2H Antibody (H00008467-M02) (0)

There are no reviews for SMARCA5/SNF2H Antibody (H00008467-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMARCA5/SNF2H Antibody (H00008467-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMARCA5/SNF2H Products

Bioinformatics Tool for SMARCA5/SNF2H Antibody (H00008467-M02)

Discover related pathways, diseases and genes to SMARCA5/SNF2H Antibody (H00008467-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCA5/SNF2H Antibody (H00008467-M02)

Discover more about diseases related to SMARCA5/SNF2H Antibody (H00008467-M02).
 

Pathways for SMARCA5/SNF2H Antibody (H00008467-M02)

View related products by pathway.

PTMs for SMARCA5/SNF2H Antibody (H00008467-M02)

Learn more about PTMs related to SMARCA5/SNF2H Antibody (H00008467-M02).

Blogs on SMARCA5/SNF2H

There are no specific blogs for SMARCA5/SNF2H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMARCA5/SNF2H Antibody (3F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCA5
Entrez
Uniprot