We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SLCO5A1 Recombinant Protein Antigen

Images

 
There are currently no images for SLCO5A1 Protein (NBP1-82498PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLCO5A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLCO5A1.

Source: E. coli

Amino Acid Sequence: SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLCO5A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82498.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLCO5A1 Recombinant Protein Antigen

  • FLJ39560
  • member 15
  • OATP5A1
  • OATPRP4
  • organic anion transporter polypeptide-related protein 4
  • SLC21A15
  • solute carrier organic anion transporter family, member 5A1

Background

Solute carrier family 21/O (SLC21/SLCO) is a group of organic anion transporters, which facilitate Na+-independent transport of organic anions and cations, including bile acids, steroid conjugates, and thyroid hormones. SLCO5A1/SLC21A15, also known as OATP5A1, has been detected at the transcriptional level in various human tissues such as those of the brain, skeletal muscle, kidney, and pancreas. Multiple transcript variants of the gene encoding OATP5A1 that are generated by alternative splicing have been registered. Substrates of the OATP5A1 transporter remain unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-68838
Species: Hu
Applications: IHC,  IHC-P
NBP1-59811
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-85770
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-74482
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-31584
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80977
Species: Hu
Applications: IHC,  IHC-P
NBP2-13349
Species: Hu
Applications: IHC,  IHC-P
NBP3-38464
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-687
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-83237
Species: Hu
Applications: IHC,  IHC-P
NBP3-45895
Species: Hu, Mu
Applications: ELISA, IHC, WB
NB100-56158
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-80980
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
H00051776-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-82498PEP
Species: Hu
Applications: AC

Publications for SLCO5A1 Protein (NBP1-82498PEP) (0)

There are no publications for SLCO5A1 Protein (NBP1-82498PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLCO5A1 Protein (NBP1-82498PEP) (0)

There are no reviews for SLCO5A1 Protein (NBP1-82498PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLCO5A1 Protein (NBP1-82498PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLCO5A1 Products

Array NBP1-82498PEP

Blogs on SLCO5A1

There are no specific blogs for SLCO5A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLCO5A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLCO5A1