SLC6A20 Antibody (3G6)

Images

 
Sandwich ELISA: SLC6A20 Antibody (3G6) [H00054716-M02] - Detection limit for recombinant GST tagged SLC6A20 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC6A20 Antibody (3G6) Summary

Immunogen
SLC6A20 (NP_064593, 301 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ
Specificity
SLC6A20 (3G6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC6A20
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC6A20 Antibody (3G6)

  • MGC161475
  • neurotransmitter transporter RB21A
  • SIT1
  • sodium- and chloride-dependent transporter XTRP3
  • Sodium/imino-acid transporter 1
  • solute carrier family 6 (neurotransmitter transporter), member 20
  • solute carrier family 6 (proline IMINO transporter), member 20
  • Solute carrier family 6 member 20
  • Transporter rB21A homolog
  • X transporter protein 3
  • XT3orphan transporter XT3
  • Xtrp3

Background

Transport of small hydrophilic substances across cell membranes is mediated by substrate-specific transporter proteins which have been classified into several families of related genes. The protein encoded by this gene is a member of the subgroup of transporter with unidentified substrates within the Na+ and Cl- coupled transporter family. This gene is expressed in kidney, and its alternative splicing generates 2 transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48784
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77078
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00009197-M07
Species: Ha, Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
NBP1-82024
Species: Hu
Applications: IHC, IHC-P
NBP1-33208
Species: Hu
Applications: ICC/IF, WB
NBP1-89327
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80524
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-03210
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00006534-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF933
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
NBP2-97655
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38748
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-47387
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-81781
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF4965
Species: Mu
Applications: IHC, Simple Western, WB
H00054716-M02
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for SLC6A20 Antibody (H00054716-M02) (0)

There are no publications for SLC6A20 Antibody (H00054716-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A20 Antibody (H00054716-M02) (0)

There are no reviews for SLC6A20 Antibody (H00054716-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC6A20 Antibody (H00054716-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC6A20 Products

Bioinformatics Tool for SLC6A20 Antibody (H00054716-M02)

Discover related pathways, diseases and genes to SLC6A20 Antibody (H00054716-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A20 Antibody (H00054716-M02)

Discover more about diseases related to SLC6A20 Antibody (H00054716-M02).
 

Pathways for SLC6A20 Antibody (H00054716-M02)

View related products by pathway.

PTMs for SLC6A20 Antibody (H00054716-M02)

Learn more about PTMs related to SLC6A20 Antibody (H00054716-M02).

Blogs on SLC6A20

There are no specific blogs for SLC6A20, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC6A20 Antibody (3G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A20
Entrez
OMIM
Uniprot