SLC6A20 Antibody (3G6) - Azide and BSA Free

Sandwich ELISA: SLC6A20 Antibody (3G6) [H00054716-M02] - Detection limit for recombinant GST tagged SLC6A20 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3G6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC6A20 Antibody (3G6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SLC6A20 Antibody (3G6) - Azide and BSA Free (H00054716-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SLC6A20 (NP_064593, 301 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ
• Specificity: SLC6A20 (3G6)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC6A20
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC6A20 Antibody (3G6) - Azide and BSA Free

• MGC161475
• neurotransmitter transporter RB21A
• SIT1
• sodium- and chloride-dependent transporter XTRP3
• Sodium/imino-acid transporter 1
• solute carrier family 6 (neurotransmitter transporter), member 20
• solute carrier family 6 (proline IMINO transporter), member 20
• Solute carrier family 6 member 20
• Transporter rB21A homolog
• X transporter protein 3
• XT3orphan transporter XT3
• Xtrp3

Background

Transport of small hydrophilic substances across cell membranes is mediated by substrate-specific transporter proteins which have been classified into several families of related genes. The protein encoded by this gene is a member of the subgroup of transporter with unidentified substrates within the Na+ and Cl- coupled transporter family. This gene is expressed in kidney, and its alternative splicing generates 2 transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC6A20
• Entrez:
  • 54716(Human)
• OMIM:
  • 605616(Human)
• Uniprot:
  • NP_064593(Human)