SLC52A3 Antibody - Azide and BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC52A3 (NP_212134.3). PGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC52A3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for SLC52A3 Antibody - Azide and BSA Free
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, WB
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IMC, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for SLC52A3 Antibody (NBP2-94430) (0)
There are no publications for SLC52A3 Antibody (NBP2-94430).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC52A3 Antibody (NBP2-94430) (0)
There are no reviews for SLC52A3 Antibody (NBP2-94430).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC52A3 Antibody (NBP2-94430) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC52A3 Products
Research Areas for SLC52A3 Antibody (NBP2-94430)
Find related products by research area.
|
Blogs on SLC52A3