SLC39A2/ZIP2 Antibody

Images

 
Immunohistochemistry: SLC39A2/ZIP2 Antibody [NBP1-86830] - Staining of human stomach shows strong positivity in chief cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P, ICC/IF (-)
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC39A2/ZIP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC39A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Control Peptide
SLC39A2/ZIP2 Protein (NBP1-86830PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC39A2/ZIP2 Antibody

  • Eti-1
  • MGC119190
  • solute carrier family 39 (zinc transporter), member 2
  • Solute carrier family 39 member 2
  • zinc transporter ZIP2
  • ZIP-2
  • ZIP2hZIP2
  • Zrt- and Irt-like protein 2,6A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-86829
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
NBP2-55609
Species: Hu
Applications: WB, ICC/IF
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
AF7315
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-31825
Species: Hu
Applications: IHC, IHC-P
NBP1-59357
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58170
Species: Hu
Applications: WB
NBP2-57274
Species: Hu
Applications: WB, ICC/IF
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-82299
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86824
Species: Hu
Applications: IHC, IHC-P
NBP2-06015
Species: Hu
H00164045-R01
Species: Hu
NBP1-86830
Species: Hu
Applications: IHC, IHC-P, ICC/IF (-)

Publications for SLC39A2/ZIP2 Antibody (NBP1-86830) (0)

There are no publications for SLC39A2/ZIP2 Antibody (NBP1-86830).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC39A2/ZIP2 Antibody (NBP1-86830) (0)

There are no reviews for SLC39A2/ZIP2 Antibody (NBP1-86830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC39A2/ZIP2 Antibody (NBP1-86830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC39A2/ZIP2 Products

Bioinformatics Tool for SLC39A2/ZIP2 Antibody (NBP1-86830)

Discover related pathways, diseases and genes to SLC39A2/ZIP2 Antibody (NBP1-86830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC39A2/ZIP2 Antibody (NBP1-86830)

Discover more about diseases related to SLC39A2/ZIP2 Antibody (NBP1-86830).
 

Pathways for SLC39A2/ZIP2 Antibody (NBP1-86830)

View related products by pathway.

Blogs on SLC39A2/ZIP2

There are no specific blogs for SLC39A2/ZIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC39A2/ZIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC39A2
Entrez
Uniprot